KEGG   Caulobacter crescentus CB15: CC_1960Help
Entry
CC_1960           CDS       T00049                                 

Definition
ATP-dependent protease LA
Orthology
K01338  
ATP-dependent Lon protease [EC:3.4.21.53]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_1960
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     CC_1960
Peptidases [BR:ccr01002]
 Serine Peptidases
  Family S16: lon protease family
   CC_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2155096..2157495)
Genome map
AA seq 799 aa AA seqDB search
MSELRTLPVLPLRDIVVFPHMVVPLFVGRDKSVRALEEVMRGDKQILLVTQKNSADDDPA
PGDIFEVGVLATVLQLLKLPDGTVKVLVEGKARAAVVSFTDQESYYEAQIGEVSEDDGAG
PEAEALSRAVVEQFENYVKLNKKVPPEALASIPQIAEPGKLADSIAAHLSVKIGDKQNLL
EIFDVVKRLEKVFALMEGEISVLQVEKKIRSRVKRQMEKTQREYYLNEQMKAIQRELGDP
DDARDELIDLEKRIKKTKLSKEARTKAESELKKLRNMSPMSAESTVVRNYLDWLLSIPWG
KAKTKKIDLVESEGILDADHYGLEKVKERILEYLAVQARTNSLKGPILCLVGPPGVGKTS
LGKSIAKATGREFVRMSLGGVRDEAEIRGHRRTYIGSMPGKVVQSMKKAKTTNAFVLLDE
IDKMGSDYRGDPASALLEVLDPSQNSTFGDHYLEVDYDLSQVMFVTTANSLNMPQPLLDR
MEIIRIPGYTEDEKLEIAKRHILPKLAKDHGLKPAEFIVPDKAIRDLIRYYTREAGVRSL
ERELGALARKTVRDLAREKVASITIDDERLAKYAGVKKYRYGETDEVDQVGIVTGLAWTE
FGGDILTIEAVKMPGKGRMQITGNLKDVMKESIAAANSYVRSRALQFGIKPPVFEKTDVH
IHVPDGATPKDGPSAGIAMALAMVSVLTGIPIRKDIAMTGEITLRGRVTAIGGLKEKLLA
ALRSGVKTVLIPQENEKDLADVPQTVKDGLEIIPVSTVDEVLKHALTGPLTPVEWNEAEE
PITTSAKKDDGDSDAMLTH
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactacgtacgcttcctgtcttgccgctgcgggatatcgttgtgttcccgcac
atggtggtgccgctatttgtgggccgcgataaatccgtgcgcgcgctcgaagaggtgatg
cgcggcgacaagcagatcctgctcgtgacgcagaagaactcggctgacgatgatccggcg
ccgggcgacatctttgaggtcggcgtgctggccaccgtgctgcagctgctgaagctgccc
gatggcaccgtgaaggttctggtcgaaggcaaggcgcgcgccgccgtcgtgagcttcacc
gatcaggagtcttactatgaggctcagatcggcgaggtttccgaagacgatggggcgggc
cctgaggccgaggcgctgtcgcgggcggtcgtcgagcagttcgaaaactacgtgaagctg
aacaagaaggtgccgccggaggccctggcgtcgatcccgcagatcgctgagcccggcaag
ctggccgacagcatcgctgcgcacctctcggtgaagatcggcgacaagcagaacctgctg
gaaatcttcgacgtcgtgaagcgcctggagaaggtcttcgccctgatggagggcgagatc
tcggtgctgcaggtcgagaagaagatccgctcgcgcgtgaagcgccagatggagaagacg
cagcgcgagtactatctgaacgagcagatgaaggcgatccagcgcgagctgggcgatcct
gacgatgcgcgcgacgagctgatcgatctcgaaaagcggatcaagaagaccaagctttcc
aaggaagcccgcaccaaggccgagagcgagctgaagaagctgcgcaacatgagcccgatg
tcggccgaaagcactgtggtccggaactacctggactggctgctgtcgatcccgtggggc
aaggccaagaccaagaagatcgacctcgtcgagagcgagggcatcctggacgccgaccac
tatggtctggagaaggtcaaggagcggatccttgagtatctggccgtgcaggcgcgcacc
aactcgctgaaggggccgatcctttgccttgtcggccctccgggcgtgggcaagacctcg
ctgggcaagtcgatcgccaaggcgaccggccgcgagttcgtgcgcatgagcctgggcggt
gtgcgcgacgaagccgagatccgcggtcaccgccgcacctacatcggctcgatgcccggc
aaggtcgtccagtcgatgaagaaggccaagacgaccaacgccttcgtcctgctggacgag
atcgacaagatgggcagcgactatcgcggcgatccggcctcggcgctgctcgaggtgctg
gacccgtcgcagaactcgaccttcggcgatcactacctggaggtcgactacgacctgtcg
caggtgatgttcgtcacgacggccaacagcctgaacatgccccagccgctgctggaccgc
atggagatcatccgcatccccggctacaccgaggacgagaagctggagatcgccaagcgg
cacatcctgcccaagctggccaaggaccatggcttgaagccggccgagttcatcgtcccc
gacaaggcgatccgcgaccttatccgctactacactcgggaagctggcgttcggtcgttg
gagcgggaactgggcgccctggcgcgcaaaacggtgcgggatctggcccgggaaaaggtc
gcctcgatcacgatcgacgacgagcgtctggccaagtacgcgggcgtgaagaagtaccgc
tacggtgagaccgacgaggtcgaccaggtcggtatcgtgacgggcctggcctggaccgag
ttcggcggcgacattctcacgatcgaagccgtgaagatgccgggcaagggtcgtatgcag
atcaccggcaatctgaaggacgtgatgaaggagtcgatcgcggccgcgaacagctatgtc
cgctcgcgcgcgctgcagttcggcatcaaaccgccggtgttcgagaagaccgacgtccac
atccacgttccggacggcgccacgcccaaggatggtccgtccgcaggcatcgccatggcc
ttggccatggtgtcggtgctgaccggtatcccgatccgcaaggacatcgccatgaccggc
gagatcaccttgcgggggcgcgttacagcgatcggcggcctgaaggagaagctgctcgcg
gcgctccggtcgggcgtcaagacggtcctgatcccgcaggagaacgagaaagacctggcg
gacgtgccgcaaaccgtgaaggacggtcttgagatcatcccggtgtcgaccgtggatgag
gtgctcaagcatgccctgaccggccccctcacgccggtggagtggaacgaggctgaggag
ccgatcaccacctctgcaaagaaggatgacggcgacagcgacgccatgctgacgcactaa

DBGET integrated database retrieval system