KEGG   Caulobacter crescentus CB15: CC_1961Help
Entry
CC_1961           CDS       T00049                                 

Gene name
clpX
Definition
(RefSeq) ATP-dependent protease ATP-binding subunit
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr04112  Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_1961 (clpX)
Chaperones and folding catalysts [BR:ccr03110]
 Heat shock proteins
  HSP100
   CC_1961 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 zf-C4_ClpX AAA ClpB_D2-small AAA_5 Mg_chelatase RuvB_N Sigma54_activat MCM AAA_22 AAA_16 PduV-EutP IstB_IS21 Sigma54_activ_2 TIP49 T2SSE TsaE NACHT AAA_25 RNA_helicase ABC_tran AAA_18 AAA_24 PhoH AAA_3 AAA_14 ResIII ATPase AAA_21 AAA_28 AAA_33 Parvo_NS1
Motif
Other DBs
NCBI-GeneID: 942736
NCBI-ProteinID: NP_420768
UniProt: P0CAU2
Position
complement(2157890..2159152)
Genome map
AA seq 420 aa AA seqDB search
MTKAASGDTKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREEHKIAFVKSK
DGVPTPREICEVLDDYVIGQGHAKKVLAVAVHNHYKRLNHASKNNDVELAKSNILLVGPT
GTGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIVLKLLQAADYNVERAQRGIV
YIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTT
NILFICGGAFAGLEKIISARGAAKSIGFGAKVTDPEERRTGEILRNVEPDDLQRFGLIPE
FIGRLPVVATLEDLDEAALVKILTEPKNAFVKQYQRLFEMENIGLTFTEDALHQVAKKAI
ARKTGARGLRSIMEGILLETMFELPTYEGVEEVVVNAEVVEGRAQPLLIYAEKKGGAASA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagccgcgagcggcgacacgaaaagcaccctgtactgctctttctgcggaaag
agccaacatgaggtgcgcaagctcatcgcgggaccgacggtgttcatttgcgatgaatgc
gtcgagctctgcatggacatcatccgcgaagagcacaagatcgccttcgtgaagtctaag
gacggcgtcccgacgccgcgcgaaatctgcgaagtcctggatgattacgtgatcggtcaa
ggtcacgccaagaaggtcctcgcggtcgcagtgcacaatcactacaagcggctgaaccac
gcttcgaagaataacgacgtcgaactggccaagtcgaacatcctgctggtcggtccgacc
ggtacgggtaagaccctgctggcgcagacgctggcccgaatcatcgacgttccgttcacg
atggcggacgccacgacgctgaccgaagccggttacgtcggcgaagacgtcgagaacatc
gtgctgaagctgctgcaggccgccgactacaacgtcgagcgcgcccagcgcggcatcgtc
tacatcgacgaaatcgacaagatcagccgcaagtccgacaacccgtcgatcactcgcgac
gtgtcgggcgagggcgtgcagcaggctctgctgaagatcatggaaggcacggtcgcctcc
gtgccgccgcagggcgggcgcaagcatcctcagcaggagttcctgcaggtcgacacgacg
aacatcctgttcatctgtggcggcgccttcgctggcctggagaagatcatctcggcgcgc
ggcgcggccaagtcgatcggcttcggcgccaaggtgaccgatcccgaagagcgccggacg
ggcgagatccttcggaacgtcgagcccgacgacctgcagcgtttcggcctgatcccggag
ttcatcggccgtctgccggtggtcgccacgctggaggatctggacgaggccgccctggtc
aagatcctgaccgagccgaagaacgccttcgtcaagcagtatcagcgcctgttcgagatg
gagaacatcggcctgaccttcaccgaagacgctctgcatcaggtggccaagaaggctatc
gcgcgcaagaccggcgcgcgcggcctgcgctcgatcatggaaggcatcctgctggagacc
atgttcgaactgccgacctacgagggcgtcgaggaagtggtggtcaacgccgaggtcgtc
gaaggccgggctcagccgctgctgatctatgccgagaaaaagggtggggcggcctcggcc
taa

DBGET integrated database retrieval system