KEGG   Caulobacter crescentus CB15: CC_1961Help
Entry
CC_1961           CDS       T00049                                 

Gene name
clpX
Definition
ATP-dependent protease ATP-binding subunit
Orthology
K03544  
ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_1961 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2157890..2159152)
Genome map
AA seq 420 aa AA seqDB search
MTKAASGDTKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREEHKIAFVKSK
DGVPTPREICEVLDDYVIGQGHAKKVLAVAVHNHYKRLNHASKNNDVELAKSNILLVGPT
GTGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIVLKLLQAADYNVERAQRGIV
YIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTT
NILFICGGAFAGLEKIISARGAAKSIGFGAKVTDPEERRTGEILRNVEPDDLQRFGLIPE
FIGRLPVVATLEDLDEAALVKILTEPKNAFVKQYQRLFEMENIGLTFTEDALHQVAKKAI
ARKTGARGLRSIMEGILLETMFELPTYEGVEEVVVNAEVVEGRAQPLLIYAEKKGGAASA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagccgcgagcggcgacacgaaaagcaccctgtactgctctttctgcggaaag
agccaacatgaggtgcgcaagctcatcgcgggaccgacggtgttcatttgcgatgaatgc
gtcgagctctgcatggacatcatccgcgaagagcacaagatcgccttcgtgaagtctaag
gacggcgtcccgacgccgcgcgaaatctgcgaagtcctggatgattacgtgatcggtcaa
ggtcacgccaagaaggtcctcgcggtcgcagtgcacaatcactacaagcggctgaaccac
gcttcgaagaataacgacgtcgaactggccaagtcgaacatcctgctggtcggtccgacc
ggtacgggtaagaccctgctggcgcagacgctggcccgaatcatcgacgttccgttcacg
atggcggacgccacgacgctgaccgaagccggttacgtcggcgaagacgtcgagaacatc
gtgctgaagctgctgcaggccgccgactacaacgtcgagcgcgcccagcgcggcatcgtc
tacatcgacgaaatcgacaagatcagccgcaagtccgacaacccgtcgatcactcgcgac
gtgtcgggcgagggcgtgcagcaggctctgctgaagatcatggaaggcacggtcgcctcc
gtgccgccgcagggcgggcgcaagcatcctcagcaggagttcctgcaggtcgacacgacg
aacatcctgttcatctgtggcggcgccttcgctggcctggagaagatcatctcggcgcgc
ggcgcggccaagtcgatcggcttcggcgccaaggtgaccgatcccgaagagcgccggacg
ggcgagatccttcggaacgtcgagcccgacgacctgcagcgtttcggcctgatcccggag
ttcatcggccgtctgccggtggtcgccacgctggaggatctggacgaggccgccctggtc
aagatcctgaccgagccgaagaacgccttcgtcaagcagtatcagcgcctgttcgagatg
gagaacatcggcctgaccttcaccgaagacgctctgcatcaggtggccaagaaggctatc
gcgcgcaagaccggcgcgcgcggcctgcgctcgatcatggaaggcatcctgctggagacc
atgttcgaactgccgacctacgagggcgtcgaggaagtggtggtcaacgccgaggtcgtc
gaaggccgggctcagccgctgctgatctatgccgagaaaaagggtggggcggcctcggcc
taa

DBGET integrated database retrieval system