KEGG   Caulobacter crescentus CB15: CC_1963Help
Entry
CC_1963           CDS       T00049                                 

Definition
ATP-dependent Clp protease proteolytic subunit
Orthology
K01358  
ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Class
Cellular Processes; Cell growth and death; Cell cycle - Caulobacter [PATH:ccr04112]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2160235..2160867)
Genome map
AA seq 210 aa AA seqDB search
MMYDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFL
ESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQ
RISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDR
DHFMSADEAKAWGLVDHVYDSRDAAEAGAE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacgatccggtttcgacggcgatgaacctggtgccgatggtggtcgagcagacc
agccgcggtgagcgcgctttcgacatcttctcgcgcctgttgaaggaacggatcatcttc
ctgaccggtccggtcgaggacggcatggccagcctgatctgcgcgcagctgctcttcctc
gagtccgagaacccgaagaaggaaatcgccatgtacatcaactcgccgggcggcgtggtg
acggctggtctcgcgatctatgacaccatgcagtacatcaagagcccggtctcgacggtg
tgcatgggtatggccgcctccatggggtcgctgctgctggccgcgggcgccgctggtcag
cgtatttcgctgccgaacgcgcggatcatggtgcaccagccgtcgggcggcttccggggc
caggcgtcggatatcgagcgtcacgccgaggacatcatcaagaccaagcgccgcctgaac
gagatttacgtcaagcactgcggccgcacctatgaagaggtcgagcgcaccctggatcgc
gaccacttcatgagcgccgacgaggccaaggcctggggcctggtcgaccacgtctacgac
agccgcgacgcggctgaagccggcgctgagtaa

DBGET integrated database retrieval system