KEGG   Caulobacter crescentus CB15: CC_2032Help
Entry
CC_2032           CDS       T00049                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CC_2032
Enzymes [BR:ccr01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     CC_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2235562..2236563
Genome map
AA seq 333 aa AA seqDB search
MHLARFPRARFAHLPTPLEPMPRLGAELGIDLWVKRDDCTGLAGGGNKTRKLEFLLGEAL
IQGADTLVTQGAVQSNHVRQTIAAGARFGLKTEVILEERTGSKASDYMGNGNVLLDKLMG
ASLRYVPGGTDMVAELDSTAENVRQRGGKPYVIPGGGSNTVGALGYVDCARELVVQADQM
DLKIDRLVTATGSAGTHAGLVAGFAALSVDIPILGFGVRAPKPKQEENVYNLAVATAETI
GAGGRVRREAVVADCDYVGEGYGLVDQGVIDALALAARTEGLLLDPVYSGKAMKGLIDQA
RKGAFKGERVVFLHTGGAQGLFGYQTVLEPALG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgctcgctttcctcgcgcccgcttcgcccacctgcccacgcccctggaaccc
atgccgcgcctcggcgcggagctggggatcgacctctgggtcaagcgcgacgactgcacc
ggcctggccggcggcggcaacaagacccgcaagctggagttcctcctcggcgaggccctg
atccagggcgccgacaccctggtgacccagggcgcggttcagtccaatcacgtgcgccag
accatcgctgccggcgcgcgctttggcctcaagaccgaggtgatcctcgaagagcgcacc
ggctccaaggccagcgactatatgggcaacggcaacgtgctgctcgacaagctgatgggc
gcgtcgctgcgctatgtgccgggcggcacggacatggtcgccgagctcgacagcactgcg
gagaacgttcgtcagcgcgggggtaagccctacgtgatccccggcggcggctcgaacacg
gtgggcgcgctcggctatgtcgattgcgcgcgcgagctcgtcgtccaggccgaccagatg
gacttgaagatcgatcgcctggtcacggcgaccggcagcgccggcacgcacgccggcctg
gtcgccggcttcgccgcgctgtccgtcgatatcccgatcctgggcttcggcgtccgcgcg
cccaagcccaagcaggaagagaacgtctataaccttgccgtcgccacggccgagacgatc
ggcgctggtggccgggtcaggcgcgaagcggtcgtcgccgactgcgactatgtcggtgag
ggctacggcctcgtggaccaaggcgtgatcgacgcgctggccctggccgcccgcaccgaa
ggtctgctgctggatcccgtctattcgggcaaggcgatgaaggggctgatcgaccaggcc
cgcaaaggcgcgttcaagggcgagcgggtcgtcttcctgcacaccggcggcgcccagggc
ctgttcggctatcagacggtgctcgagccggcgctgggatag

DBGET integrated database retrieval system