KEGG   Caulobacter crescentus CB15: CC_2126Help
Entry
CC_2126           CDS       T00049                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ccr  Caulobacter crescentus CB15
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ccr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ccr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2331973..2332488
Genome map
AA seq 171 aa AA seqDB search
MSMPTLAIVVARAANGVIGRDGDLPWRLKSDLALFKANTLFKPIIMGRKTWDSLPRKPLP
GRTNIVLSRDQSFEPEGAVACETWMEAFEIAREQAADDGADEVCVIGGSALFELALPKAK
RLYLTEVAAEVEGDVRFPAFDESAWTEVRREAHPAGDGDDHAFVFRVLERR
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcccaccctcgccattgtcgtcgcccgcgccgccaatggggtgatcggtcgc
gacggcgacctgccctggcgcctgaaatcggatctggctctgttcaaggccaacaccctg
ttcaagcccatcatcatgggccgcaagacctgggacagcctgccgcgcaagcccttgcct
ggccggaccaatatcgtgctgtcccgcgaccagagcttcgagcccgagggcgcggtggcc
tgcgagacctggatggaggcgtttgagatcgcgcgcgaacaggccgccgatgatggcgct
gacgaggtctgcgtgatcggcggcagcgccttgttcgaactggccctgcccaaggccaag
cgcctctatctcaccgaggtggccgccgaggtcgagggggacgttcgctttcccgccttc
gacgagtccgcctggaccgaggtacgccgcgaggcccacccggctggcgacggcgatgat
cacgccttcgtctttcgcgttctggagcgacgctaa

DBGET integrated database retrieval system