KEGG   Caulobacter crescentus CB15: CC_2253Help
Entry
CC_2253           CDS       T00049                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ccr00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2450829..2451809)
Genome map
AA seq 326 aa AA seqDB search
MEEPAPLVSIPEAPVPDHGKAEWFRGADGATLRAATFFPAGPARGSVVLSPGRSEPLEKY
FEVVDDLLARDFAVLLHDWRGQGLSARALPDRLKGHARGFKTFVSDYEALLDAFETRMPK
PWIAVSHSMGGCLTTLALAQGETRFAAAVLSAPMLGLNTAGVPPWLARPLAFVMSRVGLA
GEYVQTPYDPLTQTFQGDGLTHDETRYDRYQAQLRAHPEIALGGMTWGWADFAISACAWL
RRSKSVEAIAIPVIILGAELDNRVLNADSESIARRIPKGRYVEVPGAFHEILVETDARRA
LFWQAFDETVDPIAAREPLISPNVSD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaccggcgcctctggtctcgattcccgaggccccggttcccgaccacggcaag
gctgaatggttccgcggcgcggatggggcgaccctccgcgccgcgacgtttttcccggca
ggccccgcccggggttcggtggtgctcagccccggacgcagcgagccgcttgagaagtat
ttcgaggtcgtcgacgaccttttggcgcgcgatttcgccgtcttgctgcatgactggcga
gggcaggggctgtcggcccgcgccttgccggaccgcctgaagggtcacgcgcgcggcttc
aagaccttcgtttccgactacgaggcgctgctcgatgcgttcgagacgcggatgcctaag
ccctggatcgcggtcagccattcgatgggcggttgcctgacgaccctggccctggcccag
ggcgagacacgtttcgccgccgccgtgttgtcggcgccgatgctgggcctcaacaccgcc
ggcgtgccgccgtggctggcgcggcctctggctttcgtgatgtcgcgggtgggtttggcc
ggcgagtacgtgcagacgccgtatgacccgctgacccagaccttccagggcgacggtctg
acccacgatgagacgcgctatgatcgctaccaggcgcaactgcgcgcccaccccgagatc
gctctggggggcatgacctggggctgggctgatttcgccatctcagcgtgcgcgtggctc
aggcgcagcaagtcggtcgaagcgatcgcgattccggtgatcattctcggcgctgaactc
gacaaccgcgtgctgaacgccgactccgagtcgatcgcacgacgtatcccgaaggggcgc
tatgtcgaggtccccggggccttccacgagattctggtcgagaccgacgcccgccgcgcg
ctgttctggcaggccttcgacgagacggtcgatccgatcgctgcgcgcgaaccgcttatt
tcgccgaacgtctcagactga

DBGET integrated database retrieval system