KEGG   Caulobacter crescentus CB15: CC_2253Help
Entry
CC_2253           CDS       T00049                                 

Definition
(RefSeq) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CC_2253
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CC_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 943179
NCBI-ProteinID: NP_421056
UniProt: Q9A642
Position
complement(2450829..2451809)
Genome map
AA seq 326 aa AA seqDB search
MEEPAPLVSIPEAPVPDHGKAEWFRGADGATLRAATFFPAGPARGSVVLSPGRSEPLEKY
FEVVDDLLARDFAVLLHDWRGQGLSARALPDRLKGHARGFKTFVSDYEALLDAFETRMPK
PWIAVSHSMGGCLTTLALAQGETRFAAAVLSAPMLGLNTAGVPPWLARPLAFVMSRVGLA
GEYVQTPYDPLTQTFQGDGLTHDETRYDRYQAQLRAHPEIALGGMTWGWADFAISACAWL
RRSKSVEAIAIPVIILGAELDNRVLNADSESIARRIPKGRYVEVPGAFHEILVETDARRA
LFWQAFDETVDPIAAREPLISPNVSD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaccggcgcctctggtctcgattcccgaggccccggttcccgaccacggcaag
gctgaatggttccgcggcgcggatggggcgaccctccgcgccgcgacgtttttcccggca
ggccccgcccggggttcggtggtgctcagccccggacgcagcgagccgcttgagaagtat
ttcgaggtcgtcgacgaccttttggcgcgcgatttcgccgtcttgctgcatgactggcga
gggcaggggctgtcggcccgcgccttgccggaccgcctgaagggtcacgcgcgcggcttc
aagaccttcgtttccgactacgaggcgctgctcgatgcgttcgagacgcggatgcctaag
ccctggatcgcggtcagccattcgatgggcggttgcctgacgaccctggccctggcccag
ggcgagacacgtttcgccgccgccgtgttgtcggcgccgatgctgggcctcaacaccgcc
ggcgtgccgccgtggctggcgcggcctctggctttcgtgatgtcgcgggtgggtttggcc
ggcgagtacgtgcagacgccgtatgacccgctgacccagaccttccagggcgacggtctg
acccacgatgagacgcgctatgatcgctaccaggcgcaactgcgcgcccaccccgagatc
gctctggggggcatgacctggggctgggctgatttcgccatctcagcgtgcgcgtggctc
aggcgcagcaagtcggtcgaagcgatcgcgattccggtgatcattctcggcgctgaactc
gacaaccgcgtgctgaacgccgactccgagtcgatcgcacgacgtatcccgaaggggcgc
tatgtcgaggtccccggggccttccacgagattctggtcgagaccgacgcccgccgcgcg
ctgttctggcaggccttcgacgagacggtcgatccgatcgctgcgcgcgaaccgcttatt
tcgccgaacgtctcagactga

DBGET integrated database retrieval system