KEGG   Caulobacter crescentus CB15: CC_2282Help
Entry
CC_2282           CDS       T00049                                 

Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CC_2282
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CC_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2479224..2481539)
Genome map
AA seq 771 aa AA seqDB search
MRTLKTFALASAATLIATAAQAAPTTWAYSAKTGVGASYEAYVDGAYKAGGKTGAVSKVW
FSIADGVLTETMYGLIHEAQIKQMRVAVETASGLAIEGADTTSKTEYLHVDAAGRPLSPA
YKITTTDRQGRFVIEKRIFTDPDRNALFVRVTVTALKGAVTPTLLLEPHMANTGGGDVGA
ASASALTAHEGKAFLSLKASKPFAKASASVLKDGDALAALKATTTSAKGAIVLAGELPKV
AKSETFDVVIGFGADAKAADRTAAATLKTGYAEVLARYNGEGAHVGWEDYLASLNELPRL
RDASEDGGKLLQASALMLKVQEDRTYAGALIASLSNPWGDTVDATKSSTGYKAVWPRDFY
QCAMALAALGDKETPLAAFHYLPTVQVGPKTPGNKGDGGWFLQKSHVDGTPEWVGVQLDQ
TAMPIMLGWKLWTWGWLPDAELKAFYGKMLKPAADFLVKGGKVNLDWNTATITPPFTQQE
RWEEQGGHSPSTTAAVIAGLVVAGDIAEAAGDAGSAELYRKTADDCAGKLEARMVTTKGT
FGDGHYYLRLNSDQDPNNKSPVEARNGQAPVAEDKMLDAGFLELVRYGVRRADDPAILAS
LPEIDDEALEDLYRVRYSFTFPGVEGSFPGWRRYGVDGYGEDTKTGANYGADNQMRPGQR
GRVWPIFTGERGHYELAVAGLSGKPDPTAVQKIRDTYVKAMELFANEGLMIPEQVWDGVG
TDSAHGYVRGEGTDSATPLAWSHAEYVKLLRSVSDGQVWDHYAPVKARYAR
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgttgaaaaccttcgccctggcctcggccgcgaccctgatcgccaccgccgcc
caggccgcgcctacgacctgggcctattcggccaagaccggtgtcggcgcctcctacgag
gcctatgtcgacggcgcctacaaggccggcggcaagaccggggcggtgtcgaaggtctgg
ttctcgatcgccgacggggtcctcaccgagacgatgtacggcctgatccatgaggcgcag
atcaagcagatgcgcgtcgccgtcgagacggcgagcggcctggccattgagggggcggat
acgacctccaagaccgagtatctgcatgtggacgccgccggccggccgctgtctccggcc
tacaagatcaccacgaccgatcgccaaggccggtttgtcatcgaaaagcgcatcttcacc
gatcccgaccgcaatgcgctgttcgtgcgcgtgacggtgacggccctgaaaggcgcggtc
acgccgaccctgctgctggagccgcacatggccaacaccggcggtggcgatgtgggcgcg
gcctcggcctcggcgctcaccgcccacgagggcaaggcgttcctcagcctgaaggccagc
aagccctttgcgaaagcctcggccagcgttctgaaggatggcgatgctctggcggctttg
aaggcgaccacgacttcggccaagggcgcgatcgtgctggccggagagctgcccaaggtc
gccaagtccgagacctttgacgtggtgatcggcttcggcgctgacgccaaggccgccgac
cggaccgccgccgcgacgctgaagacgggctacgccgaggtcctggcccgctacaacggc
gagggcgcgcatgtgggctgggaggactatctggcctcgctgaacgaactgccgcgactg
cgcgacgcgtccgaggacggcggcaagcttctccaggccagcgccctgatgctcaaggtg
caggaagaccgcacctatgccggcgccctgattgcctcgctgtccaacccctggggcgac
acggtcgacgcgaccaagtcctcgaccggctacaaggccgtctggccgcgcgacttctat
cagtgcgccatggccttggcggccctgggcgacaaggagacgccgctggcggccttccac
tatctgcccacggtccaggtcgggcccaagacgccgggcaacaagggcgacggcggctgg
ttcctgcagaagtcgcacgtcgacggcacgcccgagtgggtcggggtccagctcgaccag
acggccatgccgatcatgctgggctggaagctctggacgtggggctggctgccggacgcc
gagctgaaggcgttctacggcaagatgctgaagccggcggccgacttcctggtcaagggc
ggcaaggtcaatctggactggaacaccgcgaccatcactccgcccttcacccagcaggag
cgctgggaagaacagggcggccactcgccctcgacgaccgccgccgtcattgcaggcctg
gtggtcgccggcgacatcgccgaggccgccggcgacgccggctcggccgaactctatcgc
aagaccgccgacgactgcgccggcaagctcgaggcccggatggtcacgacgaaggggacc
ttcggcgacggccactattatctgcgtctcaacagcgaccaggacccgaacaacaagagc
ccggtcgaggcgcgtaacggccaggctccggtggccgaggacaagatgctggacgcgggc
ttcctggagctggtgcgctatggcgttcgccgcgccgatgatccggcgatcctggccagc
ctgccggagattgatgacgaggccctcgaagacctctaccgcgttcgctacagcttcacg
ttccctggcgtggagggcagcttccccggctggcgccgctacggcgtcgacggctacggc
gaggacaccaagaccggcgccaactacggcgccgacaaccagatgcgtcccggccaaagg
ggccgggtgtggccgatcttcaccggcgagcgtgggcactacgagctggccgtggcgggc
ctctcgggcaagcccgatcccaccgccgtgcagaagatccgcgatacctacgtcaaggcg
atggagttgttcgccaacgagggactgatgatccccgagcaggtctgggacggcgtcggg
accgacagcgctcatggctatgtccggggcgaggggaccgattcggccacgcccctggcc
tggagccacgcggagtacgtcaagctgctgcgatcggtcagcgacgggcaggtctgggat
cactatgcgcccgtaaaggcgcggtacgcgcgctag

DBGET integrated database retrieval system