KEGG   Caulobacter crescentus CB15: CC_2462Help
Entry
CC_2462           CDS       T00049                                 

Gene name
pleD
Definition
(RefSeq) response regulator PleD
  KO
K02488  
two-component system, cell cycle response regulator [EC:2.7.7.65]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Two-component system
Cell cycle - Caulobacter
Module
PleC-PleD (cell fate control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_2462 (pleD)
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_2462 (pleD)
Enzymes [BR:ccr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     CC_2462 (pleD)
Two-component system [BR:ccr02022]
 Cell cycle family
  PleC-PleD [MD:M00511]
   CC_2462 (pleD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2668598..2669962)
Genome map
AA seq 454 aa AA seqDB search
MSARILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMD
GFTVCRKLKDDPTTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLT
RFKLVIDELRQREASGRRMGVIAGAAARLDGLGGRVLIVDDNERQAQRVAAELGVEHRPV
IESDPEKAKISAGGPVDLVIVNAAAKNFDGLRFTAALRSEERTRQLPVLAMVDPDDRGRM
VKALEIGVNDILSRPIDPQELSARVKTQIQRKRYTDYLRNNLDHSLELAVTDQLTGLHNR
RYMTGQLDSLVKRATLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNVRA
IDLPCRYGGEEFVVIMPDTALADALRIAERIRMHVSGSPFTVAHGREMLNVTISIGVSAT
AGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccggatcctcgtcgtcgacgacatcgaggccaatgtccgcctgcttgaggcc
aagctgacggccgagtactatgaggtctccaccgccatggacgggccgacggccctggct
atggccgcgcgcgatctgcccgacatcattctgctggacgtcatgatgcccggcatggac
ggcttcaccgtctgccgtaagctgaaggacgatccgactacccgccacatcccggtggtg
ctgatcaccgcgctcgacgggcgtggcgaccgcatccagggcctggaatcgggcgcttcg
gacttcctgaccaagccgatcgacgacgtcatgctgttcgcccgcgtgcgcagcctgacc
cgcttcaagctggtgatcgacgaactgcgtcagcgcgaggcctcgggccgccgcatgggc
gtgatcgccggcgccgccgcgcgcctggacggtctgggcggtcgggtgctgatcgtcgac
gacaacgaacgccaggctcaacgcgtcgccgccgagctgggcgtcgaacaccgcccggtg
atcgagagcgaccctgagaaggccaagatcagcgccggcggtccggtcgacctggtcatc
gtcaacgctgcggccaagaacttcgatggcctgcgcttcaccgccgcgctgcggtccgag
gaacgcacccgccagttgcccgtgctggccatggtcgatcccgatgatcgtggccgcatg
gtcaaggcgctggagatcggcgtgaacgacatcctgtcgcgcccgatcgatccgcaggaa
ctgtccgcgcgcgtcaagacgcagatccagcgcaagcgctacactgactatctgcgcaac
aatctggatcactcgctggagctggccgtcaccgaccagctgaccggcctgcacaatcgc
cgctacatgaccggtcagctcgactcgctggtcaagcgcgcgacactgggcggcgatccg
gtttcggccctgctgatcgacatcgatttcttcaagaaaatcaacgacaccttcggtcac
gatatcggcgacgaggtgctgcgcgagttcgccttgcgtctggcctcgaacgtccgcgcc
attgatctgccttgccgctatggcggggaagagttcgtggtgatcatgcccgacaccgcc
ctggctgacgccctgcgcatcgccgagcggatccggatgcatgtctccggctcgcccttc
acggtcgcccatggccgcgaaatgctgaacgtcaccatctcgatcggcgtctcggccacg
gcgggcgagggcgacacgcccgaagccctgctcaagcgcgccgacgaaggcgtttatcag
gccaaggcctcgggtcggaacgcggtggtcggcaaggccgcctga

DBGET integrated database retrieval system