KEGG   Caulobacter crescentus CB15: CC_2463Help
Entry
CC_2463           CDS       T00049                                 

Definition
polar differentiation response regulator
Orthology
K11443  
two-component system, cell cycle response regulator DivK
Organism
ccr  Caulobacter crescentus CB15
Pathway
Two-component system
Cell cycle - Caulobacter
Module
PleC-PleD (cell fate control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_2463
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_2463
Two-component system [BR:ccr02022]
 Cell cycle family
  PleC-PleD [MD:M00511]
   CC_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2669959..2670351)
Genome map
AA seq 130 aa AA seqDB search
MVGVRMTKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQ
LPEISGLEVTKWLKEDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLET
IKRLLERQPA
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggtcggggtaaggatgacgaagaaggtcctcatcgtggaggataacgagctgaacatg
aagctctttcatgatctgctcgaagcccagggttacgagaccctgcagacccgtgagggt
ctgtcggcgctgtccattgcccgcgaaaacaagccagacctgattctgatggacatccag
ctgcccgaaatctcgggtctggaggtcaccaagtggctgaaggaagacgacgacctggcc
cacattcctgtggtggcggtgaccgccttcgccatgaagggggatgaggagcgcatccgc
gagggcggttgcgaggcctatatctccaagccgatctcggtcgtgcacttcctcgagacc
atcaagcgcctgctggaaaggcagcctgcatga

DBGET integrated database retrieval system