KEGG   Caulobacter crescentus CB15: CC_2541Help
Entry
CC_2541           CDS       T00049                                 

Definition
cell division protein FtsA
Orthology
K03590  
cell division protein FtsA
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2747495..2748766)
Genome map
AA seq 423 aa AA seqDB search
MRQPAIAAVDLGASKVTCFIMKADGVHRDNRTLTTAGVGYVQSRGVRGGAIVNLDEAAQA
IAQAVERAETVAGVSVQGVSVCTAGGQLASHRVHTQVSLGARPIGDGDLSRAIASALAQV
RIPGRKPIHLLPIAWSVDGQRGIRDPRAMFGRALGLELLVVSVNENIFHTLAHCVERAHL
SFEGIVAAPFASALAALEEDEMDLGAVCIDMGGGSTSVAVFNNGALCHVDSLAVGGGHVT
QDIARGLQTSVVGAERIKTLHGSAIASANEDREMIEAPPRGDDPGAGPVIAPRSLLKGII
QPRVEETLELLRERLKASGAPVEPGAGIVLTGGASQLAGVREVAVRVFDRPVRLGRPRRV
PHLADAASGPAFCAAAGVLHRTAFGPREAVSSKALAGGVARKRPIDPNASPMAKAAAWLR
DNL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccagcccgccatcgcggccgtcgatctgggcgcgtcgaaggtgacgtgcttcatc
atgaaggctgacggcgtccaccgggataaccgcactctgacgaccgcgggtgtgggctat
gtgcagtcgcgcggcgtgcgcggcggcgcgatcgtcaatctggacgaggccgcccaggcg
atcgcccaggccgtggagcgcgccgagaccgtggccggcgtcagcgtccagggcgtcagc
gtctgcaccgccggcggccagctggccagccaccgcgtgcacacccaggtctcgctgggc
gcccgtccgatcggcgacggcgacctgtcgcgcgccatcgcctcggccctggcccaggtc
cgcattccgggccgcaagccgatccacctcctgcccatcgcctggtcggtcgacggtcag
cgcggcatccgtgatccccgcgccatgttcggccgcgccctggggctggagctgctggtg
gtctcggtcaacgagaacatcttccacaccctggcccactgcgtggagcgcgcccacctg
tcgttcgaggggattgtcgctgcgcccttcgcctcggccctggcggccctggaagaggac
gagatggatctgggcgccgtctgcatcgacatgggcggcggctcgacctcggtggcggtg
ttcaacaatggcgcgctctgccacgtcgacagcctggccgtcggcggcggtcacgtgacc
caggacatcgcgcgcggcctgcagacctcggtcgtgggcgccgagcgcatcaagaccctg
catggcagcgccatcgcctcggccaacgaggatcgtgagatgatcgaggcgccgccgcgt
ggcgacgatccgggcgcgggtccggtgatcgctccgcgcagcttgctcaagggcatcatc
cagccgcgcgtcgaagagaccctggaactgctgcgcgagcgcctgaaggcctcgggcgcg
ccggtcgagccgggcgcgggcatcgtgctgaccggcggcgccagccagctggccggtgtg
cgcgaagtggccgtgcgcgtcttcgaccgtcccgttcgcctgggtcgtccgcgccgggtg
ccgcatctggccgacgccgcgtcgggcccggccttctgcgccgccgccggcgtcctgcac
cgtaccgcctttggcccgcgcgaggcggtctcgtccaaggccctggccggcggcgtggct
cgcaagcgtcccatcgaccccaacgccagcccgatggccaaggcggccgcctggctgcgc
gacaatctctaa

DBGET integrated database retrieval system