KEGG   Caulobacter crescentus CB15: CC_2542Help
Entry
CC_2542           CDS       T00049                                 

Definition
cell division protein FtsQ
Orthology
K03589  
cell division protein FtsQ
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Class
Cellular Processes; Cell growth and death; Cell cycle - Caulobacter [PATH:ccr04112]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2748851..2749747)
Genome map
AA seq 298 aa AA seqDB search
MRGGPPKPRRPRAEAPASPSKGKPAPRKAQPAAKLHAARGVGLSPTVALSVAGAALGLGL
VVMLATGHRAERLGASMVRGVDNTFASAGFRLKTVHIRGASATAQADILKASGLYLDQPT
LGMDLADVRDRVQGVGWVKDAKVVRMLPDTVLIAVEERPALAVWQNHGRMKVIDSEGQVI
TEADPARFPQLPLVVGQGADQAAGLILPAVASRPRLRDRLEAMVRVDERRWDLRLKDGSL
IQLPAIDEESALIQLDQLDQRQRILDMGFARIDLRDPEMVAVRPRDAVLPGQPAADGA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggggggaccgcctaagcctaggcgaccccgggccgaagcgcccgcaagtccgagt
aaaggtaagccggcgccccgcaaggcgcagccggctgcgaagctgcacgctgcgcgcggc
gtgggcctgtcgcccacggtggccctcagcgtggccggcgcggccctgggtcttggtctt
gtggttatgctcgcgaccggccatcgcgccgagcgcctcggcgcgtccatggtccgcggc
gtcgacaacaccttcgcctccgccggcttcaggctgaagaccgtccatatccgcggcgcc
tcggcgaccgcccaggccgatatcctcaaggcttcgggcctgtacctggaccagccgacc
ctgggcatggacctcgccgacgtgcgggaccgcgtccagggcgtgggctgggtcaaggac
gccaaggtcgtgcgcatgctgcccgacaccgtgctgatcgcggttgaggaacggccggct
ctggcggtctggcagaaccacggccgcatgaaggtcatcgacagcgaaggtcaggtcatc
accgaggccgatccggcgcggttcccgcagctgccgctggtggtggggcagggcgccgat
caggccgccggcctgatcctgccggccgtcgcctcgcgtccgcgcctgcgtgaccggctg
gaagcgatggtccgggtggacgagcgccgctgggacctgcggctgaaggacggctcgctg
atccagctgccggccatcgacgaagaatccgcgctgattcaattggatcagctcgaccaa
aggcagcgaatcctggacatgggttttgcgcggattgatctgcgcgaccccgaaatggtg
gctgtgagaccccgcgacgcggtgctgcccgggcagcctgcggctgacggggcgtaa

DBGET integrated database retrieval system