KEGG   Caulobacter crescentus CB15: CC_2551Help
Entry
CC_2551           CDS       T00049                                 

Gene name
murG
Definition
N-acetylglucosaminyl transferase (EC:2.4.1.227)
Orthology
K02563  
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CC_2551 (murG)
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_2551 (murG)
Enzymes [BR:ccr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     CC_2551 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2759262..2760347)
Genome map
AA seq 361 aa AA seqDB search
MSKLAVVAAGGTGGHMFPAQALAEALAARGWRVVLATDDRGALYADKFPAEERLALSAAT
AKSNDPLGMIKAGFVVLQGVMEARAAFKRLDPAVVVGFGGYPALPALLGALSQGRPTVIH
EQNAVLGRVNRFLAPRVNEVACAFPILEKATPAVKACAHVVGNPVRPPVRALFDVPYLAP
EVQLRVLVTGGSQGARLLSELIPEAVAKLPEEMRGRLKVFQQARAESMEQARKVYRNAMV
ECEVAPFFRDMAGYLRQSHLVIGRSGASTCTELAVAGRPSILIPLKIAADDHQRFNARLL
EEAGGAAVCLEDELTVDVMAAALKALLSKPERLEKMAAGARSAAKPNAAEELADLVEKTA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctggctgttgtcgccgccgggggaaccggcggccatatgttccccgcccag
gccctggccgaggcgctggctgcgcgcggctggcgggtggtgctggccaccgacgatcgc
ggcgccctctacgccgacaagttccccgccgaagagcggctggccctgtcggcagccacc
gccaagtcgaacgacccgctgggcatgatcaaggccggcttcgtggtcctgcagggggtg
atggaggcccgggcggcgttcaagcgtctcgaccccgctgtcgtggtcggcttcggcggc
tatccggcgctaccggcgctgctgggcgcgctgtcgcagggccgcccgaccgtcatccac
gaacagaacgccgtgctgggccgcgtgaaccgcttcctggccccgcgcgtcaatgaagtg
gcctgcgccttcccgatcctggagaaggccacccccgccgtgaaggcctgcgcccatgtg
gttggcaatccggtgcgtccgccggtgcgcgcgctgttcgacgtgccctatctggcgccc
gaggtgcagcttcgcgtgctggtcaccggcggcagccagggcgcgcgcctgctctccgaa
ctgatccccgaggcggtggccaagctgcccgaggagatgcgcggccgattgaaagtgttc
cagcaggcccgggccgaaagcatggagcaggcccgcaaggtctatcgcaacgccatggtc
gagtgcgaagtggcgccgttcttccgcgacatggccgggtatctccgccagtcgcacctg
gtcatcggccgctcgggcgcctcgacctgcaccgagctggccgtggccggccggccctcg
atcctgattccgctgaagatcgccgccgacgaccaccagcgcttcaacgcccgcctgctg
gaagaggccggcggcgcggccgtgtgcctcgaggatgaactgaccgtcgacgtgatggcc
gcggcgctgaaggccctgctgtccaagcccgaacgcctggaaaagatggcggcgggagcg
cggtcagccgccaagccgaacgcggccgaggaactggcggatctggtggagaagacggcg
cgctaa

DBGET integrated database retrieval system