KEGG   Caulobacter crescentus CB15: CC_2551Help
Entry
CC_2551           CDS       T00049                                 

Gene name
murG
Definition
(RefSeq) N-acetylglucosaminyl transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00550  Peptidoglycan biosynthesis
ccr01100  Metabolic pathways
ccr01502  Vancomycin resistance
ccr04112  Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CC_2551 (murG)
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_2551 (murG)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CC_2551 (murG)
Enzymes [BR:ccr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     CC_2551 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:ccr01011]
 Precursor biosynthesis
  Glycosyltransferase
   CC_2551 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 941036
NCBI-ProteinID: NP_421354
UniProt: Q9A5A1
Position
complement(2759262..2760347)
Genome map
AA seq 361 aa AA seqDB search
MSKLAVVAAGGTGGHMFPAQALAEALAARGWRVVLATDDRGALYADKFPAEERLALSAAT
AKSNDPLGMIKAGFVVLQGVMEARAAFKRLDPAVVVGFGGYPALPALLGALSQGRPTVIH
EQNAVLGRVNRFLAPRVNEVACAFPILEKATPAVKACAHVVGNPVRPPVRALFDVPYLAP
EVQLRVLVTGGSQGARLLSELIPEAVAKLPEEMRGRLKVFQQARAESMEQARKVYRNAMV
ECEVAPFFRDMAGYLRQSHLVIGRSGASTCTELAVAGRPSILIPLKIAADDHQRFNARLL
EEAGGAAVCLEDELTVDVMAAALKALLSKPERLEKMAAGARSAAKPNAAEELADLVEKTA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctggctgttgtcgccgccgggggaaccggcggccatatgttccccgcccag
gccctggccgaggcgctggctgcgcgcggctggcgggtggtgctggccaccgacgatcgc
ggcgccctctacgccgacaagttccccgccgaagagcggctggccctgtcggcagccacc
gccaagtcgaacgacccgctgggcatgatcaaggccggcttcgtggtcctgcagggggtg
atggaggcccgggcggcgttcaagcgtctcgaccccgctgtcgtggtcggcttcggcggc
tatccggcgctaccggcgctgctgggcgcgctgtcgcagggccgcccgaccgtcatccac
gaacagaacgccgtgctgggccgcgtgaaccgcttcctggccccgcgcgtcaatgaagtg
gcctgcgccttcccgatcctggagaaggccacccccgccgtgaaggcctgcgcccatgtg
gttggcaatccggtgcgtccgccggtgcgcgcgctgttcgacgtgccctatctggcgccc
gaggtgcagcttcgcgtgctggtcaccggcggcagccagggcgcgcgcctgctctccgaa
ctgatccccgaggcggtggccaagctgcccgaggagatgcgcggccgattgaaagtgttc
cagcaggcccgggccgaaagcatggagcaggcccgcaaggtctatcgcaacgccatggtc
gagtgcgaagtggcgccgttcttccgcgacatggccgggtatctccgccagtcgcacctg
gtcatcggccgctcgggcgcctcgacctgcaccgagctggccgtggccggccggccctcg
atcctgattccgctgaagatcgccgccgacgaccaccagcgcttcaacgcccgcctgctg
gaagaggccggcggcgcggccgtgtgcctcgaggatgaactgaccgtcgacgtgatggcc
gcggcgctgaaggccctgctgtccaagcccgaacgcctggaaaagatggcggcgggagcg
cggtcagccgccaagccgaacgcggccgaggaactggcggatctggtggagaagacggcg
cgctaa

DBGET integrated database retrieval system