KEGG   Caulobacter crescentus CB15: CC_2628Help
Entry
CC_2628           CDS       T00049                                 

Definition
hfaA protein
Orthology
K13585  
holdfast attachment protein HfaA
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Class
Cellular Processes; Cell growth and death; Cell cycle - Caulobacter [PATH:ccr04112]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2844439..2844882
Genome map
AA seq 147 aa AA seqDB search
MAWHRNIKTRGAMVVAAVTLGASGVAAAQSMSTNSASFNAGYGRSSGQESRMVEYSTRDA
NGNRVVVDGVMLTGSDQSVFSSSRSSGSLDAYSGVGAVGGYAGSTAIGNNLTVITQGNNN
TVIVNSSQVNSGNVTAGANVVKGGTPK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcatcggaacatcaagacgcgtggggcgatggtcgtcgccgccgtcacgctc
ggcgcaagcggcgtcgccgcggcccaatcgatgtcgaccaattcggcttcgttcaacgcc
ggctatggccgcagctcgggccaggaaagccggatggtcgagtattcgacccgcgacgcc
aacggcaaccgggtggtcgtggacggcgtcatgctgaccggctcggaccagagcgttttc
tcgtccagccgcagctcgggctcgctggacgcctattcgggcgtcggcgccgtgggcggt
tacgccggctcgaccgcgatcggcaacaatctgacggtcatcacccagggcaacaacaat
accgtcatcgtcaattccagccaggtgaacagcgggaatgtcaccgccggcgcgaacgtc
gtgaagggcggtactccgaaatga

DBGET integrated database retrieval system