KEGG   Caulobacter crescentus CB15: CC_2629Help
Entry
CC_2629           CDS       T00049                                 

Definition
hfaB protein
Orthology
K13586  
holdfast attachment protein HfaB
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2844879..2845892
Genome map
AA seq 337 aa AA seqDB search
MMVKRTGAVLALLATAALSACGSTPVASTAGNYAKPIGTAPVTANPTDYSSALVCLNQYA
RTNRIVAPRIAIGRIADYTGKEESDGSGRKVTQGASLMAVSAFAKAGMPLVERFDTSVSE
FELKYANNKLISDRPNPAPDAPADFRKILAGQVPGSDFYVIGGITELNYNIRSAGIDAYA
GDKDTDGLKGNFRRRVFIMNIALDLRLVNTRTLEVVDVISYQKQVVGREVSAGVFDFLNG
NLFDISAGRGALEPMQLAVRALIERATVEMAANLYGMPGPESCLRFDPFGDATVGQTGAF
TPAYNNLGTNNAQTRDDPSRWNARRDPDIRDAKRGRY
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcaagcgcacaggcgcggtcctggccctgctggccaccgcggcgctcagcgcc
tgcggcagcacgccggtggcctcgacggccggcaactacgccaagcccattggcacagcg
ccggtgacggccaatcccaccgactactcttccgcgctcgtttgcctgaaccagtatgcg
cgcacgaaccgtatcgtcgccccgcgcatcgcgatcggccggatcgccgactataccggc
aaggaagagtccgacggctcgggccgcaaggtcacccagggcgcctcgctgatggcggtc
tcggccttcgccaaggccggcatgccgctggtcgaacgcttcgacacctcggtgtcggag
ttcgagctgaagtacgccaacaacaagctgatctcggatcgccccaaccccgcgcccgac
gcgccggccgacttccgcaagatcctggccggccaggtgccgggctcggacttctatgtc
atcggcggcatcaccgagctgaactacaacatccgctcggccggcattgacgcctatgcc
ggcgacaaggacaccgacggcctgaagggcaacttccgccgccgcgtcttcatcatgaac
atcgcgctggacctgcggctggtgaacacccgcaccctcgaggtggtggatgtcatctcg
tatcagaagcaggtggtcggtcgcgaagtcagcgccggcgtcttcgacttcctcaatggc
aatctcttcgacatctcggccggtcgcggggcgctggagccgatgcagctggcggtccgc
gccctgatcgagcgcgccaccgtcgagatggccgccaatctctacggcatgcccggtccg
gaaagctgcctgcgctttgatccgttcggtgacgccaccgtcggtcagacgggcgccttc
acgccggcctacaacaatctgggaacgaacaatgcgcagacccgcgatgacccgtctcgc
tggaacgctcgccgcgatcccgatatccgtgatgctaagcggggtcgctactag

DBGET integrated database retrieval system