KEGG   Caulobacter crescentus CB15: CC_2935Help
Entry
CC_2935           CDS       T00049                                 

Definition
cytochrome C, membrane-bound
Orthology
K08738  
cytochrome c
Organism
ccr  Caulobacter crescentus CB15
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ccr00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ccr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3158871..3159557
Genome map
AA seq 228 aa AA seqDB search
MSDLTFNKIAGGVLLTGLVIFGLREASSIVFSKPEVEKAGYEIAVQEESAGGAAVVESLP
DWNAVLTPANVAAGQAVAAKCAACHKFDASNANGTGPGLWDVVGRKPAAHADFNYSTGMK
EFAAKTPVWDYDHLYEFLKAPGKYVSGTNMTFVGLKKQEDRIAMIAYMHSLGSKLPVPPP
RPVAAPAPAEGAAPAAEGAAPAAEGAAPAAAGAAPAAPAAAAPAAPKA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctgacgttcaacaagatcgctggcggcgtgctgctgaccggcctcgttatt
ttcggtctgcgggaagcgtcctcgatcgtcttctccaagcccgaagtcgagaaggccggc
tacgagatcgcggtccaggaagaaagcgccggcggcgcggcggtggtcgagagcctcccc
gactggaacgccgtgctgacgccggccaatgtggccgccggccaggctgtcgcggccaag
tgcgccgcctgccacaagttcgacgcctccaacgccaacggcacgggccccggcctgtgg
gacgtggtcggccgcaagccggcggcgcacgcggacttcaactactcgaccggcatgaag
gaattcgcggccaagaccccggtctgggactacgaccacctgtatgaattcctgaaggcg
ccgggcaagtatgtctcgggcacgaacatgacgttcgtgggcctgaagaagcaggaagac
cgcatcgcgatgatcgcctacatgcacagcctgggttcgaagctgccggtcccgccgccg
cgtccggtcgccgccccggctccggccgaaggcgcggcgcccgccgctgaaggcgcggct
ccggccgccgaaggcgccgccccggcggctgctggcgctgctccggccgccccggccgcc
gccgccccggccgccccgaaggcctaa

DBGET integrated database retrieval system