KEGG   Caulobacter crescentus CB15: CC_2961Help
Entry
CC_2961           CDS       T00049                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CC_2961
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     CC_2961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3184269..3184658)
Genome map
AA seq 129 aa AA seqDB search
MSSTAPSPAQVVRAFMKAMERLDYDAAVQHLAPACEYTNPPPIGTVHGPAGVRAVLEPFF
APTLENEFRILREATDGGLVFHERLDRHRLKDGWVELPVTGVYEVVDGKIAYWRDYFDAQ
TILSQWPRG
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgaccgccccgtcccccgcccaggtcgtccgcgccttcatgaaggccatggag
cggctcgactacgacgccgccgtccagcatctggcgccggcctgcgagtatacgaacccg
ccgccgatcggcacggtccatggtccggccggggtgcgcgcggtgctggagcctttcttc
gcgccgaccctggagaacgagttccggatcctgcgagaggcgacagacggcgggctcgtc
ttccacgagcgcctggatcggcatcgcctgaaggacggttgggtcgagttgccggtgacc
ggtgtctatgaggtcgtcgacggcaagatcgcctattggcgcgactatttcgacgcccag
accatcctaagccagtggccgcgcgggtag

DBGET integrated database retrieval system