KEGG   Caulobacter crescentus CB15: CC_3035Help
Entry
CC_3035           CDS       T00049                                 

Definition
cell cycle transcriptional regulator CtrA
Orthology
K13584  
two-component system, cell cycle response regulator CtrA
Organism
ccr  Caulobacter crescentus CB15
Pathway
Two-component system
Cell cycle - Caulobacter
Module
CckA-CtrA/CpdR (cell cycle control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_3035
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_3035
Two-component system [BR:ccr02022]
 Cell cycle family
  CckA-CtrA/CpdR [MD:M00512]
   CC_3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3252967..3253662)
Genome map
AA seq 231 aa AA seqDB search
MRVLLIEDDSATAQTIELMLKSEGFNVYTTDLGEEGVDLGKIYDYDLILLDLNLPDMSGI
DVLRTLRVAKINTPIMILSGSSEIDTKVKTFAGGADDYMTKPFHKDEMIARIHAVVRRSK
GHAQSVIKTGDIVVNLDAKTVEVNGNRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYG
GMDEPELKIIDVFICKLRKKLAASAHGKHHIETVWGRGYVLRDPNEQVNAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtactgttgatcgaggatgacagcgcgacggcgcagaccatcgaactgatgctg
aagtctgaaggcttcaacgtctatacgacggatctgggtgaagaaggcgtcgatctgggc
aagatctacgactacgatcttatcctgctcgacctcaatcttccggacatgagcggcatc
gatgttctgcgcaccctgcgggtcgcgaagatcaacacgcccatcatgatcctgtcgggc
tcgtcggaaatcgacaccaaggtcaagaccttcgccggcggcgccgacgactacatgacc
aagccgttccacaaggacgaaatgatcgcccgcatccacgcggtggtccgtcgttcgaag
ggtcacgcccagtcggtcatcaagaccggcgacatcgtggtcaacctggacgccaagacg
gtggaagtgaacggcaaccgcgttcacctgaccggcaaggagtaccagatgctggagctc
ctctccctgcgcaagggtacgaccctgaccaaggaaatgttcctgaaccacctgtacggc
ggcatggacgagccggaactgaagatcatcgacgtcttcatctgcaagctgcgcaagaag
ctggccgcttcggcgcacggcaagcaccacattgagacggtctggggccgcggctatgtg
ctgcgcgacccgaacgagcaggttaacgccgcctga

DBGET integrated database retrieval system