KEGG   Caulobacter crescentus CB15: CC_3042Help
Entry
CC_3042           CDS       T00049                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ccr  Caulobacter crescentus CB15
Brite
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CC_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3258649..3259641
Genome map
AA seq 330 aa AA seqDB search
MQSQPVADTPLKSIASTPVGACLQRHQLDDPAFAALLTRHYSQITAEWEMKMEYILQDDG
RFRFDRPDAIADFARRHGLRLHGHALIWYSQVMPAFRALDGQGKRFADAYRNYILAVAGR
YRGLAASWDVINEAVDDNGVDLRRSAWTDNLGVDEHMILAFHHAKEADPDAVLFINDYNL
ENNPTKRATFLRMVERLLKAGAPIGGIGTQSHLGLDFTPPGMCRIALRDLASLGLPIHVS
ELDISFGDKPETAPLPKLLSRQADLARELAQAYMDLPRAQRFAFTVWGVRDRDSWLRGAN
GERPWEHPLPLDDAGQPKPMFQALAEVLSG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgcagagccagcccgtcgccgacacgcctctgaagtcgatcgcctcgaccccggtcggc
gcctgcctgcagcgccaccagctggacgatcccgccttcgccgccctgctcacccgccac
tacagccagatcacggccgagtgggaaatgaagatggagtacatcctccaggacgacggg
cggttccggttcgaccggcccgacgccatcgccgacttcgcccgccgccacggcctgcgg
ctgcatggccacgccctgatctggtacagtcaggtgatgcccgccttccgcgccctggac
ggccagggcaagcggttcgccgacgcctatcgcaactacatcctggcggtcgcgggccgc
tatcgcgggctggcggccagctgggacgtcattaacgaggcggtcgacgacaacggcgtc
gacctgcgacgctcggcctggaccgacaatctgggcgtcgatgagcacatgatcctggcg
tttcaccacgccaaggaggccgaccccgacgcggtcctgttcatcaacgactacaatctc
gagaacaatccgaccaagcgggcgaccttcctgcggatggtcgaacggctgctgaaggcc
ggcgcgccgatcggcggcatcggcacccagagccatctgggtctggacttcaccccgccg
gggatgtgccggatcgccctgcgcgatctggccagccttggcctgccgatccatgtctcc
gagctggacatctccttcggcgacaagccagaaaccgcccccttgccgaagctgctgagc
cgccaggccgacctcgcccgcgagctggcgcaggcctatatggacctgccgcgcgcgcag
cggttcgccttcaccgtctggggcgtgcgcgaccgggactcctggctgcgcggcgcgaac
ggcgagcgcccctgggagcaccccttgcccctcgatgacgccggccagcccaagccgatg
ttccaggccctggctgaggtgctgtcggggtag

DBGET integrated database retrieval system