KEGG   Caulobacter crescentus CB15: CC_3167Help
Entry
CC_3167           CDS       T00049                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CC_3167
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CC_3167
   00052 Galactose metabolism
    CC_3167
   00500 Starch and sucrose metabolism
    CC_3167
   00520 Amino sugar and nucleotide sugar metabolism
    CC_3167
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CC_3167
   00524 Butirosin and neomycin biosynthesis
    CC_3167
Enzymes [BR:ccr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CC_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3412438..3413385
Genome map
AA seq 315 aa AA seqDB search
MNGRDLALALVSPGDAPRGHRDLACASLKALEEHLIDAVSEHSADGLIGAAVCGAGPEID
GAIALTAGDFTLTQAWLRAVLKTPRVSLLNDFAACALGAPRLAPSAMRLIHEGKPGRNAQ
IAVIGPNLGLGVAALTPHRTDGWTPVVSEGGHIDFTPGEPREVPVFEALQARHGRVSAEH
FLSQQGLADIYAALGGGLDDSDEVILARVRDGDETAREALSIFSALLGAFAGDAALSFAA
RGGVYINSPLMERIDGLLDQAAFSRRFEDKGRMSAYLKDIPVYLAVGRCTLLGLSALFTA
SDLRYEAAEVKVLDC
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggtcgcgatctggccctggcgctggtcagtccgggcgacgcgccgcgcggacat
cgcgatctagcctgcgcgtcgctcaaagcgcttgaagagcacctgatcgacgccgtgtcc
gagcattcggctgacggcctgatcggagccgctgtctgcggcgccggccccgaaatcgac
ggcgcgatcgcgctgacggccggcgacttcacgctgacccaggcctggttgcgcgcggtg
ctgaagacgccgcgcgtctcgctgttgaacgacttcgccgcctgcgccctgggcgcgccc
cgcctggccccgtcggccatgcgcctgatccacgagggcaagcccggccgcaacgcccag
atcgccgtgatcggtcccaatctcggtctcggcgtcgccgccctgacgccccaccgaacc
gacgggtggacgcccgtagtcagcgagggtgggcatatcgacttcacccccggcgagccc
cgcgaagtcccggtgttcgaggcgctgcaagcccggcacggccgggtctcggcggagcat
ttcctgtcacagcagggcctcgccgatatctatgcggccctgggcggcgggctggacgat
agcgacgaggtcatcctcgcccgggtccgggacggcgacgagacggcgcgggaagccctg
tcgatcttcagcgccctcttgggggccttcgcgggagacgccgccctcagcttcgcggcc
cggggaggcgtctatatcaacagccccctgatggaacgcatcgatggcctgctcgatcag
gccgccttcagccggcgctttgaggacaagggccggatgagcgcctatctcaaggacatc
ccggtctatctcgccgtcgggcggtgcacgctgctgggcttgtccgcgctcttcaccgcc
agcgacctgcgatacgaagccgccgaggtgaaggtcctcgactgctga

DBGET integrated database retrieval system