KEGG   Caulobacter crescentus CB15: CC_3237Help
Entry
CC_3237           CDS       T00049                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CC_3237
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CC_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3499231..3499848)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGAVAEVGEEEALIDVMGVGYLVRCGHRTLQRLPALGEETLLHIESQWSESAGLR
LYGFLTREDRRAFVLLQAIQGVGPKAAMAVLDVLSPAELASAVAREDKAAVGRANGVGPK
LALRIVTELKDKPITDGPVLMSAPTSSAPSAPAKPAPTGDAVAALMGLGVAEVNARRVVE
AAAAELGEEATVQALIKAGLKELGR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccgcctgcgcggggccgtcgccgaggtcggcgaggaagaggccctgatcgac
gtcatgggcgtcggctatctggttcgctgcggtcaccgcaccctccagcgcctgccggcc
ctgggcgaagagaccctgttgcacatcgagagccagtggagcgagagcgcaggcctgcgg
ctctacggcttcctcactcgcgaggaccgccgcgccttcgtgctgttgcaagcgatccag
ggtgtgggaccgaaggccgccatggcggtgctggacgtgctgtcgccggccgagctggcc
agcgccgtggcgcgcgaggacaaggccgccgtcggtcgcgccaacggggtggggccgaag
ctggccctgcgtatcgtcaccgagctgaaggacaagccgatcaccgacgggccggtgctg
atgagcgccccgacctcgtccgcgccgtccgcgcccgccaagcccgccccgaccggcgac
gccgttgcggccctgatgggcctgggcgtggccgaggtgaacgcccgccgcgtggtcgag
gccgccgccgccgagctgggtgaagaggcgacggtccaggcgctgatcaaggcgggcctc
aaggagcttgggcgatga

DBGET integrated database retrieval system