KEGG   Caulobacter crescentus CB15: CC_3295Help
Entry
CC_3295           CDS       T00049                                 

Definition
hypothetical protein
Orthology
K13592  
regulator of CtrA degradation
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_3295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3546681..3547190
Genome map
AA seq 169 aa AA seqDB search
MTEVNAFADTPWRAGVIQDFARSELFDRTFEEGMQLVEETAAYLDGAGRHDSKVLSRNAA
LGYATESMRLTTRLMQVASWLLVQRAVREGEMPPEAACAEAYRLAEEAPADGPAVEELPF
GLMNLLQRSERLYERVRHLDRRMYVESPNEEAPRPVQNQLDRLTAAFGG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtgaacgcgttcgcggacacgccttggcgcgctggagtgatccaggatttc
gcgcgatcggaactgttcgaccggacgttcgaggaaggcatgcaactggtcgaagagacc
gccgcctatctcgacggggccggacgccatgacagcaaggtcctctctcgcaacgccgcc
ctgggctacgccaccgaaagcatgcgcctgaccacgcgcctgatgcaggtcgcctcctgg
cttttggtgcagcgcgccgtacgtgaaggcgagatgccgccggaagccgcctgcgctgaa
gcctatcgcctggccgaagaggccccggccgatggtccggccgtcgaggaactgccgttt
ggcctgatgaacctgctgcagcgctccgagcgcctgtacgagcgcgtccgccacctggac
cgccgcatgtatgtcgagtcgccgaacgaagaagcgccgcgtccggttcagaaccagctc
gatcgcttgacggcggcgttcggaggctaa

DBGET integrated database retrieval system