KEGG   Caulobacter crescentus CB15: CC_3384Help
Entry
CC_3384           CDS       T00049                                 

Definition
(RefSeq) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00072  Synthesis and degradation of ketone bodies
ccr00650  Butanoate metabolism
ccr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CC_3384
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CC_3384
Enzymes [BR:ccr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CC_3384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase MR_MLE_C
Motif
Other DBs
NCBI-GeneID: 943788
NCBI-ProteinID: NP_422178
UniProt: Q9A322
Position
complement(3628274..3629071)
Genome map
AA seq 265 aa AA seqDB search
MAVDFGLQGQVAIVTGSTSGIGHAMADALAAQGCNIVMNGLGEMNAIERARAEMAETHGV
EVLYHGADMTRPIEIADMVRAAKAEFGELDILVNNAGVQHVAPVEDFPEDKWDLIIAVNL
SSAFHATKAAVPIMKEQGRGRIVNIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAQ
HGITCNAICPGFVKTPLVEAQIADQAKARGISEEAVMRDVILASQPTKQFVTFDQLNGML
LYLVSDLGASANGAAYQIDGGWVAQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgatttcggtttgcaggggcaggtcgccatcgtcaccggctcgaccagcggc
atcggccacgccatggccgacgcgctcgccgcccagggctgcaacatcgtcatgaacggt
cttggtgaaatgaacgccatcgagcgcgcccgcgccgagatggccgagacacacggcgtg
gaggtgctctaccacggcgccgacatgaccaggccgatcgagatcgccgacatggtccgc
gcggccaaggccgagttcggcgagctggacatcctcgtcaacaacgccggcgtccagcat
gtggccccggtcgaggacttcccggaagacaagtgggacctgatcatcgctgtgaacctg
tcctcggccttccacgccaccaaggcggccgtgccgatcatgaaggagcagggccggggg
cggatcgtcaacatcgcctcggcgcacggcttggtggcctcgccgttcaagagcgcctat
gtcgccgccaagcacgggatcatgggcctgaccaagacggtcgccctcgaggtcgcccag
catgggatcacctgcaacgccatctgcccgggctttgtgaagacgccgctggtcgaggct
cagatcgccgaccaggccaaggcgcgcggcatttcggaagaggcggtgatgagggacgtg
atcctggccagccagccgaccaagcagttcgtcaccttcgaccagctgaacggcatgctt
ctgtatctggtctcggacctgggcgcctcggccaatggcgcggcctatcagatcgacggc
ggctgggtcgcccaatag

DBGET integrated database retrieval system