KEGG   Caulobacter crescentus CB15: CC_3396Help
Entry
CC_3396           CDS       T00049                                 

Definition
diguanylate cyclase
Orthology
K13245  
c-di-GMP-specific phosphodiesterase [EC:3.1.4.52]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_3396
Enzymes [BR:ccr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.52  cyclic-guanylate-specific phosphodiesterase
     CC_3396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3638756..3640423)
Genome map
AA seq 555 aa AA seqDB search
MSFRTGERRIWDATATLEALGAADVALWIWEPETDRLRLNGAARALGLGPLAPECSSAAF
RALALPQDRAQAEEVLKPREPGSEVVARFRVRGGETCLWRGVWLEEGVRAAGVVAPETKF
SASELCDLTGLLDRRSFLARARERLAQEGTHQLVVADLDRLRRLNEALGHERADLVLAAL
GSRLAAAFPAQSILGRIGEDEFAVLCQPLGYEPSDVLRSALEQPLRVAGFDIHPTLSIGA
VSAEGGLDAPDAAELLRRAELAVEAAAAAGRGGAAAYGRAMETDGLSRLALEADLRGAIG
RGEITPYFQPIVRLSTGALSGFEALARWIHPRRGMLPPDEFLPLIEEMGLMSELGAHMMH
AAAQQLSTWRAAHPAMGNLTVSVNLSTGEIDRPGLVADVAETLRVNRLPRGALKLEVTES
DIMRDPERAAVILKTLRDAGAGLALDDFGTGFSSLSYLTRLPFDTLKIDRYFVRTMGNNA
GSAKIVRSVVKLGQDLDLEVVAEGVENAEMAHALQSLGCDYGQGFGYAPALSPQEAEVYL
NEAYVDGAAPVKARG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcggacaggcgaacgacgaatctgggacgcgacggccacgcttgaggcgctg
ggcgcggcggacgtcgccctgtggatctgggagcccgaaaccgacaggttgcgtctgaac
ggcgcggcgcgcgccttgggccttgggccgctggcgcctgaatgctcgtcggccgccttc
cgcgccctggccctgccgcaggatcgcgcccaggccgaagaggtcctgaagccgcgtgaa
ccgggcagcgaagtcgtcgcccgtttccgcgtgcgcggcggcgagacctgcctctggcgc
ggcgtctggctggaagagggcgtgcgcgccgccggcgtcgtggcgcccgaaacgaaattc
tccgcgtccgagctttgcgacctgaccggacttctggaccgtcgcagcttcctcgcccgc
gcccgcgagcgcctggcgcaggaggggacccaccagttggtcgtcgccgacctcgaccga
ctgcgtcgcctgaacgaggcgctgggtcacgagcgcgcggacctagtcctggcggcgctg
ggctcgcgcctggcggcggcgttcccggcccagtcgatcctgggccggatcggcgaggac
gagttcgccgttctctgccagccgctcggctacgaaccctccgatgtgctgcgcagcgcg
ctggagcagccgctgcgcgtggccggctttgatattcacccgaccctgtcgatcggcgcg
gtctcggccgaaggcggcctggacgcgccggacgccgccgaactgctgcgccgcgccgaa
ctggccgtcgaggccgccgccgccgccggccgaggcggcgcggccgcctatggccgggcg
atggagaccgacggcctgtcgcgcctggcgctggaggctgatctgcgcggcgccattggt
cggggcgagatcacgccctacttccagccgatcgtgcggctgtcgaccggcgccctgtcc
ggcttcgaggccctggcccgctggatccatccgcgccggggcatgctgccgccggacgag
ttcctgccgctgatcgaagagatggggctgatgagcgagctcggcgcgcacatgatgcac
gccgccgcccagcagctgtcgacctggcgcgccgctcacccggcgatggggaacctgact
gtcagcgtcaacctgtcgaccggcgagatcgaccggcccggcctggtcgccgacgtggcc
gagaccctgcgggtcaatcgcctgccgcgcggcgccctgaagctggaagtcaccgaaagc
gacatcatgcgcgatcccgaacgggccgccgtgatcctgaagacgctgcgcgacgcgggc
gcagggcttgcgctggacgacttcggcaccggcttctcgtcgctgtcgtacctgacgcgc
ctgccgttcgacacgctgaagatcgaccgctacttcgtccgcaccatgggcaataacgcc
ggctcggccaagatcgtccgctcggtggtcaagctgggccaggatctggatctggaagtc
gtcgccgaaggggtcgagaacgccgagatggcgcatgcgctgcaatcgctgggctgtgac
tatggccaaggctttggctatgcgccggccctgtcgccgcaggaggccgaggtctatctg
aacgaggcctatgtcgacggcgccgcgccggtgaaggcgcggggttaa

DBGET integrated database retrieval system