KEGG   Caulobacter crescentus CB15: CC_3470Help
Entry
CC_3470           CDS       T00049                                 

Definition
hypothetical protein
Orthology
K13588  
histidine phosphotransferase ChpT
Organism
ccr  Caulobacter crescentus CB15
Pathway
Two-component system
Cell cycle - Caulobacter
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CC_3470
 Cellular Processes
  Cell growth and death
   04112 Cell cycle - Caulobacter
    CC_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Structure
PDB: 

Jmol
Position
3713924..3714685
Genome map
AA seq 253 aa AA seqDB search
MRYFLQAPIAARPRPGLRMAQITAEFAAMTETVTETTAPASPEADVQGPDFAAMLAARLC
HDFISPASAIVSGLDLLEDPSAQDMRDDAMNLIASSARKLADLLQFTRVAFGASASAENF
DSRELEKLAQGVFAHVRPTLDWQIEPQAMNKPSSRAVLNIAQIAASALPAGGVATVKGVA
ADGRFSIIADAKGPRARLRPEVLAGLKGEPLAEGLGGPWVQAAYLNALVRAAGGQIAVEI
GEDRASIAAWVPA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttattttctccaagcgccgatagcggcgcggcccaggcccggtttgcgaatggct
caaatcacggcagagttcgccgccatgaccgagaccgtcaccgagaccaccgcccccgcg
tcccccgaagccgacgtccagggtcccgatttcgccgccatgctggccgcgcgcctgtgt
cacgacttcatcagtccggccagcgccatcgtctcgggcctggatctgctggaagacccc
tcggcccaggacatgcgcgacgacgccatgaacctgatcgcctcctcggcccgcaagctg
gcggacctcttgcagttcacccgagtggccttcggcgcctcggcctcggccgagaacttc
gactcgcgcgaactggaaaagctggcccagggcgtctttgcccatgtccgcccgaccctg
gactggcagatcgagccgcaggcgatgaacaagccctcgtcgcgcgcggtgctgaacatc
gcccagatcgccgccagcgccctgccggccggcggcgtggccaccgtcaagggcgtggcc
gccgacgggcgcttctcgatcatcgccgacgccaagggcccgcgcgcgcgcctgcgtccg
gaggtgctggcgggcctaaagggcgagccgctggccgagggcctgggcggtccgtgggtg
caggcggcctatctgaacgccctggtgcgcgcggccggcggccagatcgccgtcgagatc
ggcgaggaccgcgcctcgatcgccgcctgggtcccggcgtaa

DBGET integrated database retrieval system