KEGG   Caulobacter crescentus CB15: CC_3543Help
Entry
CC_3543           CDS       T00049                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00260  Glycine, serine and threonine metabolism
ccr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccr01100  Metabolic pathways
ccr01110  Biosynthesis of secondary metabolites
ccr01130  Biosynthesis of antibiotics
ccr01230  Biosynthesis of amino acids
Module
ccr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CC_3543 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC_3543 (trpA)
Enzymes [BR:ccr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CC_3543 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-GeneID: 940747
NCBI-ProteinID: NP_422337
UniProt: P12291
Position
complement(3792449..3793276)
Genome map
AA seq 275 aa AA seqDB search
MTKDRIDRRFAALKAENRAGFVTYVMAGDPDAATTLSVLKGLPAAGADLIELGFPFSDPM
AEGPTIQRAAQRGLKSGMTLQGTLDLVAAFREGDQDTPIILMGYLNPVLNKGFETFAALA
AKAGVDGLIIVDCPPEEADPLSDALEAEGIALIRLAAPTTDDARLPMVVRRTSGFVYYVS
VAGVTGVKSADAADVAPAVERLRKASGLPVAVGFGIRTPDQAAAVAKVADAAVVGSALVD
EIESAAQLNENVTEKVLLKASELAKAVRSARVGTK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaagaccgtatcgatcgccgctttgcggcgctgaaggccgaaaaccgcgccggc
ttcgtgacctatgtcatggccggcgaccctgacgccgccacgacgctgtccgtgctcaag
ggcctgcccgccgccggcgcggatctgatcgagctgggctttccgttctctgatccgatg
gctgagggcccgaccatccagcgcgccgcccagcggggcctgaagtccggcatgaccctg
cagggcacgctggatctggtggccgccttccgcgaaggcgaccaggacacgccgatcatc
ctgatgggctatctgaacccggttctgaacaagggctttgagaccttcgcagcgctggcc
gccaaggccggggtcgacggcctgatcatcgtcgactgcccgcccgaagaggccgacccg
ctgtcggacgcgctggaagccgagggcatcgccctgattcgtctcgcggccccgaccacc
gatgacgcccgcctgccgatggtggtgcgccgcacctcgggcttcgtctattacgtctcg
gtcgccggggtgaccggagtgaagtcggccgacgcggccgatgtggcccccgccgtcgag
cgcctgcgcaaggcctcgggcctgccggtcgccgtgggctttggtatccgcacgccggac
caggccgccgccgtcgccaaggtggcggacgcggccgtcgtcggctcggccctggtcgat
gaaatcgagtcggcggcgcagttgaacgaaaacgtgaccgagaaggttcttctaaaagcg
tcggagctggctaaggctgtgcgctcggcgcgagtcgggacgaagtga

DBGET integrated database retrieval system