KEGG   Caulobacter crescentus CB15: CC_3544Help
Entry
CC_3544           CDS       T00049                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CC_3544
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CC_3544
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CC_3544
Enzymes [BR:ccr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CC_3544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3793289..3794521)
Genome map
AA seq 410 aa AA seqDB search
MEALVNAPAKPNDYSAYPDAEGRFGGFGGRYVAETLMPLVLDLGKAYADAKADPEFQAQL
KSYNTHYAGRPSPLYFAERLTEHFGGAKIYFKRDELNHTGSHKINNALGQILLAMRMGKT
RIIAETGAGQHGVATATVCARFGLPCVVYMGATDVERQKPNVFRMNLLGAEVRPVSSGTG
TLKDAMNEAMRDWVTNVHDTYYLIGTAAGPHPYPVMVRDFQSVIGAEAREQILEMEGRLP
DAVVACIGGGSNAIGLFHPFLGDEGVRLIGVEAAGHGVSTDKHAASLTGGRPGVLHGNRT
YLLQDDDGQIIDAHSISAGLDYPGIGPEHSFLHDIGRAEYVSTTDTEALEAFKLCSTLEG
IIPALEPAHALARVGEIAQELGKGKIVVMNLCGRGDKDIFTVAEALGRKI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttggaagccctcgtgaacgctcctgcgaaacccaatgactactcggcctatcccgatgcg
gagggccgctttggcgggttcggcggccgctatgtcgccgagaccctgatgccgctggtc
ctggacctgggcaaggcctatgccgacgccaaggccgatccggaattccaggcgcagctg
aaaagctacaacacccattacgctggccggccgagcccgctctatttcgccgagcgcctg
accgagcacttcggcggggccaagatctatttcaagcgcgacgagctgaatcacaccggc
tcgcacaagatcaacaacgccctgggccagatccttctggccatgcgcatgggcaagacc
cggatcatcgccgagaccggcgctggccagcacggcgtggccaccgccaccgtctgcgcc
cgctttggcctgccctgcgtggtctatatgggcgccaccgacgtcgagcggcagaagccc
aatgtcttccgcatgaacctgctgggcgcggaagttcgccccgtcagctcgggcaccggc
accctgaaggacgccatgaacgaagcgatgcgcgattgggtgaccaacgtgcatgacacc
tattacctgatcggcacggccgccggcccgcacccctatccggtgatggtccgtgacttc
cagagcgtgatcggcgccgaagcgcgtgagcagatcctcgaaatggaaggccgactgccc
gacgcggtggtcgcctgcatcggcggcggctccaacgccatcggcctcttccacccgttc
ctcggcgacgagggtgtgcgcctgatcggcgtcgaggcggccggccacggcgtctccacc
gacaagcacgccgcctcgctgaccggcggccgtcctggcgtgctgcacggcaaccgcacc
tacctgctgcaggacgacgacggccagatcatcgacgctcactcgatctcggctggcctc
gactatccgggcatcggccccgagcactcgttcctgcacgacatcggccgcgccgaatat
gtctcgaccacggacaccgaggccttggaggccttcaaactgtgctcgacgctggaaggc
atcatcccggccctggagccggcccacgccctggcccgggtcggcgagatcgcccaggag
ctgggcaagggcaagatcgtggtgatgaatctctgcggtcgcggcgacaaggacatcttc
acggtggccgaagccctcgggcgcaagatctag

DBGET integrated database retrieval system