KEGG   Caulobacter crescentus CB15: CC_3633Help
Entry
CC_3633           CDS       T00049                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ccr  Caulobacter crescentus CB15
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ccr00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ccr00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3892172..3892729
Genome map
AA seq 185 aa AA seqDB search
MKITPLAIPEVLLITPARHGDERGWFSETFRQSALEEAGFQAAFVQDNHVRSTTRGIQRG
LHYQKPPHAQDKLLRCVVGSIFDVAVDIRKGSPTFGHWVGAELSAENRQQLLVPKGFAHG
YVTLSDACEVLYKVTDYYAPQAEGGVRWSDPAIGIEWPIPLNEITANDRDNAAPLLAEIE
TPFAY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcacgccgttggcgatccccgaagtgctgcttatcacgcccgcgcgccatggc
gatgagcgcggctggttttccgagacgttccggcaatcggcgctggaggaggccggattc
caggccgccttcgtccaggacaatcacgtgcgttcgacgacacgcggcatccagcgcggc
ctgcactaccagaagccgccgcacgcccaggacaagctgctgcgctgcgtggtgggatcg
atcttcgacgtcgcagtcgacatccgcaaaggctcgccgaccttcggccactgggtcggg
gccgagctgtcggccgagaatcggcagcaactgctggtgcccaagggcttcgcccacggt
tatgtcaccctgagcgacgcctgcgaggtgctctacaaggtcaccgactactacgcgccc
caggccgagggcggcgtacgctggagcgatccggccatcgggatcgaatggccgataccg
ttgaacgagatcacggccaatgatcgcgacaacgccgccccgctgctggcggagatcgag
acgcctttcgcgtactga

DBGET integrated database retrieval system