KEGG   Caulobacter crescentus CB15: CC_3637Help
Entry
CC_3637           CDS       T00049                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ccr  Caulobacter crescentus CB15
Pathway
ccr00040  Pentose and glucuronate interconversions
ccr00052  Galactose metabolism
ccr00500  Starch and sucrose metabolism
ccr00520  Amino sugar and nucleotide sugar metabolism
ccr01100  Metabolic pathways
ccr01130  Biosynthesis of antibiotics
Module
ccr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CC_3637
   00052 Galactose metabolism
    CC_3637
   00500 Starch and sucrose metabolism
    CC_3637
   00520 Amino sugar and nucleotide sugar metabolism
    CC_3637
Enzymes [BR:ccr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CC_3637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CoA_transf_3
Motif
Other DBs
NCBI-GeneID: 940677
NCBI-ProteinID: NP_422431
UniProt: Q9A2C8
Position
3895725..3896600
Genome map
AA seq 291 aa AA seqDB search
MKPVRKAVLPVAGLGTRVLPGTKTTPKELLNVVDRPILSYIVEEGRKAGIEHFVFVTGRS
KGAIEDYFDHQIELEAQLEAKGKIEILEQLRAELPKPGEMSFVRQMAPLGLGHAVWCARD
IIGDEPFAVMLPDVIVDAERACLGQLIDLYNKVGGGNVIGVEEVPESETHKYGVVAPGKV
DGRMATMTGMVEKPAKGTAPSNWAIAGRYILQPEIFALLAAQEKGAGNEIQLTDSMAKLM
QDQAFHAYVYEGVTHDCGDKIGLLRANVALALKRADLGAAARAAVEAALKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgttcgcaaagctgttcttccggtcgccggtctcggtacgcgtgtcctgccg
ggcaccaagaccacgccaaaggaactgctgaacgtcgtcgatcgaccaattctttcctac
attgtcgaggaaggtcgcaaggcgggcatcgaacacttcgtcttcgtcaccggccgctcg
aagggcgcgatcgaggactatttcgatcatcagatcgagcttgaggcgcagctggaagcc
aagggcaagatcgagatccttgaacagctgcgcgccgagttgcccaagcccggcgagatg
agcttcgtgcgccagatggcccccctgggcctgggccacgccgtctggtgcgcccgtgac
atcatcggcgacgagcccttcgcggtcatgctgccggacgtcatcgtcgacgccgagcgc
gcctgcctcggccaactgatcgacctctacaacaaggtcggcggcggcaatgtcatcggc
gtcgaggaagtgccggaaagcgagacccacaagtacggcgtcgttgcgcccggcaaggtc
gatggccgcatggcgaccatgaccggcatggtcgagaagccggcgaagggcacggcgccg
tccaactgggcgatcgccggccgctatatcctgcagcccgagatcttcgccctgctggcc
gctcaggagaagggcgccggcaacgagatccagctgaccgattcgatggccaagctgatg
caggaccaggccttccacgcctatgtctatgagggcgtcacccacgactgcggcgacaag
atcggcctgctacgcgccaatgtggccctggccttgaagcgcgccgacctgggcgccgcc
gcccgcgcggcggtcgaggcggcgctgaaggcctaa

DBGET integrated database retrieval system