KEGG   Chondromyces crocatus: CMC5_080140Help
Entry
CMC5_080140       CDS       T04010                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccro  Chondromyces crocatus
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ccro00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMC5_080140 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    CMC5_080140 (atoB)
   00640 Propanoate metabolism
    CMC5_080140 (atoB)
   00650 Butanoate metabolism
    CMC5_080140 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    CMC5_080140 (atoB)
   00072 Synthesis and degradation of ketone bodies
    CMC5_080140 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CMC5_080140 (atoB)
   00310 Lysine degradation
    CMC5_080140 (atoB)
   00380 Tryptophan metabolism
    CMC5_080140 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CMC5_080140 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CMC5_080140 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CMC5_080140 (atoB)
Enzymes [BR:ccro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CMC5_080140 (atoB)
Exosome [BR:ccro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMC5_080140 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
10796347..10797531
Genome map
AA seq 394 aa AA seqDB search
MTLPVPVYIVAATRTPIGAFQGALSSLTAPRLGAAAIEAALQRANLPADAIEEVFMGNVL
SAGIGQAPARQAAIFAGIPDKVPATTINKVCGSGLQAVVFGAKTIALGDADLVVAGGMES
MSNVPYYLPQARTGYRMGNNSVVDGMIHDGLWDPYGNFHMGVAGDKCAKEHGFSREAQDE
YAKESFRRALAAQKEGQFDAEIVPVSVPQKKGDPVVVKLDDGPGAGKPDKFASLRPAFQK
DGTVTAANASSINDGASALILASEKAVKERGLTPLGRILGYGGAAQAPEWFTTAPAAAIA
NTTKKLGITTEQIDLYEVNEAFAVVAMAVNKLSNLDPQKVNVRGGAVALGHPIGASGARV
LTTLLYTLKDQNKKRGLATLCIGGGEALALVVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgtccccgtgtacatcgtcgccgccacccgtacgcccatcggcgcgttc
cagggtgcgctctcctcgctgacggcaccgcgcctcggcgccgcggccatcgaggcggcg
ctccagcgcgccaacctccccgccgacgccatcgaggaggtgttcatggggaacgtgctc
tcggccgggatcggccaggcgcccgcgcgccaggccgcgatcttcgccgggatcccggac
aaggtgcccgcaacgacgatcaacaaggtgtgtggctcgggcctgcaggcggtggtcttc
ggggcgaagacgatcgcgctgggcgacgcggacctggtggtggccggcggcatggagtcg
atgtcgaacgtgccgtactacctgccgcaggcgcggacgggctaccggatggggaacaac
tcggtcgtggacgggatgatccacgatggcctgtgggacccgtacgggaacttccacatg
ggcgtcgccggcgacaagtgcgcgaaggagcacgggttcagccgcgaggcgcaggacgag
tacgcgaaggagagcttccgccgggcgctggccgcgcagaaagaggggcagttcgacgcg
gagatcgtgccggtgagcgtgccgcagaagaagggcgatccggtcgtggtgaagctcgac
gacggtccgggcgcgggcaagcccgacaagttcgcgtcgctccggccggcgttccagaag
gacgggacggtgacggcggcgaacgcttcgtcgatcaacgacggcgcgagcgcgctgatc
ctggcgagcgagaaggcggtgaaggagcgggggctgacgccgctcgggcggatcctgggc
tacggtggcgcggcgcaggcgccggagtggttcaccacggcgccggccgcggcgatcgcg
aacacgacgaagaagctcggcatcaccacggagcagatcgatctgtacgaggtgaacgag
gcgttcgcggtggtggcgatggccgtgaacaagctgagcaacctcgacccgcagaaggtg
aacgtgcgcggcggggcggtggcgctcggtcaccccatcggcgcgagcggcgcgcgcgtg
ctgacgacgctgctctacacgctgaaggaccagaacaagaagcggggcctggcgacgctg
tgcatcggcggcggcgaggccctggcgctggtggtcgagcgatga

DBGET integrated database retrieval system