KEGG   Caulobacter crescentus NA1000: CCNA_00071Help
Entry
CCNA_00071        CDS       T00841                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCNA_00071
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CCNA_00071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72950..73636
Genome map
AA seq 228 aa AA seqDB search
MVSGAPVWITRAQPGAAATAQRVAALGFRPVVDPLLAIEPSLAKIDLSGIAALAFTSANG
VEGFARCNARRDLPVFTVGAATAKAAKDAGFAHAFSAEGDVEALERLIIDARPGPVLWAG
AQAPAGDLVAALRAQGLEARGVAVYATVERAPSPATLALLDAPLSVLVHSPRAARALGRI
LAGRDHGDLRLLCLSPAVAAPLDKIAEPRFVASAPRPDESALLQLLDA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttggtctcgggcgcgccggtctggatcacccgcgcccagcctggcgctgcggcgacggcg
cagagggtggccgcgctcggctttaggccggttgtcgacccactcctggccatagagccg
agcctggcgaagattgacctctccggtatcgccgccctggccttcaccagcgccaacggc
gtcgaggggtttgcgcgctgcaacgcccgtcgtgatcttccggtcttcacggtgggcgcg
gcgacggccaaggccgccaaggatgcgggcttcgcccacgcgttcagcgccgaaggtgat
gtcgaggccctggagcggctgatcatcgacgcgcgccccggtcctgtgctgtgggcgggc
gctcaggcgccggcgggcgatctcgtcgccgccttgcgcgcccagggtctggaagcgcgc
ggcgtggcggtctacgccaccgtggagcgcgcgccgtcccccgccactctggccctgctc
gacgcgccgctgagtgtgctggttcattccccacgcgcggcccgcgccctgggacggatc
ctggcgggccgcgaccatggcgatctgcgcctcctctgcctgtcccccgccgtcgccgcg
ccgttggacaagatcgctgaaccgcgttttgtggcgtccgcgccgcgcccggacgaatct
gcgctgctccagctgctcgacgcttga

DBGET integrated database retrieval system