KEGG   Caulobacter crescentus NA1000: CCNA_00071Help
Entry
CCNA_00071        CDS       T00841                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ccs00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72950..73636
Genome map
AA seq 228 aa AA seqDB search
MVSGAPVWITRAQPGAAATAQRVAALGFRPVVDPLLAIEPSLAKIDLSGIAALAFTSANG
VEGFARCNARRDLPVFTVGAATAKAAKDAGFAHAFSAEGDVEALERLIIDARPGPVLWAG
AQAPAGDLVAALRAQGLEARGVAVYATVERAPSPATLALLDAPLSVLVHSPRAARALGRI
LAGRDHGDLRLLCLSPAVAAPLDKIAEPRFVASAPRPDESALLQLLDA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttggtctcgggcgcgccggtctggatcacccgcgcccagcctggcgctgcggcgacggcg
cagagggtggccgcgctcggctttaggccggttgtcgacccactcctggccatagagccg
agcctggcgaagattgacctctccggtatcgccgccctggccttcaccagcgccaacggc
gtcgaggggtttgcgcgctgcaacgcccgtcgtgatcttccggtcttcacggtgggcgcg
gcgacggccaaggccgccaaggatgcgggcttcgcccacgcgttcagcgccgaaggtgat
gtcgaggccctggagcggctgatcatcgacgcgcgccccggtcctgtgctgtgggcgggc
gctcaggcgccggcgggcgatctcgtcgccgccttgcgcgcccagggtctggaagcgcgc
ggcgtggcggtctacgccaccgtggagcgcgcgccgtcccccgccactctggccctgctc
gacgcgccgctgagtgtgctggttcattccccacgcgcggcccgcgccctgggacggatc
ctggcgggccgcgaccatggcgatctgcgcctcctctgcctgtcccccgccgtcgccgcg
ccgttggacaagatcgctgaaccgcgttttgtggcgtccgcgccgcgcccggacgaatct
gcgctgctccagctgctcgacgcttga

DBGET integrated database retrieval system