KEGG   Caulobacter crescentus NA1000: CCNA_00270Help
Entry
CCNA_00270        CDS       T00841                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ccs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284558..285160
Genome map
AA seq 200 aa AA seqDB search
MAASAGPEIERLIALLSKLPGLGPRSGRRAALALLKKRDTLLAPLATAMAEAQAKVRTCG
TCGSLDVTDPCAVCADGSRDGRLLCVVEEVGSVWAMERGGSFKGRYHVLGGLLSALDGIG
PEALRIGELVGRVADGSVAEVILALPATVDGQTTAHYIADRLAKTNVPVTMLARGVPVGG
DLDWLDDGTIAQALRARRPA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctccgccggacccgagatcgagcgcctgatcgccctgctgtccaagctgccg
ggcctgggaccgcgctcgggccggcgggcggccctggccctcttgaagaagcgcgacacc
ttgctggcgccgctggccaccgccatggccgaggcgcaggccaaggttcgcacctgcggg
acctgcggctcgctggacgtcaccgatccctgcgccgtctgcgcggacggctcccgcgat
ggccgcctgctgtgcgtggtcgaggaggtgggctcggtctgggccatggagcgcggcggc
tcgttcaagggccgctatcacgtgctgggcgggctgctgtcggcgctggacgggattgga
cccgaggccttgcggatcggcgagctggtcggccgggttgcggacggatccgtcgccgag
gtgatcctggccctgcccgccacggtcgatggccagacgaccgcccactacatcgccgac
cgtctggccaagaccaatgtgccggtgactatgttggcgcgcggcgtgccggtgggcggc
gacctcgattggctggacgacggcacgatcgcccaggcgctgcgggcacggcggccggct
tga

DBGET integrated database retrieval system