KEGG   Caulobacter crescentus NA1000: CCNA_00277Help
Entry
CCNA_00277        CDS       T00841                                 

Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00300  Lysine biosynthesis
ccs01100  Metabolic pathways
ccs01120  Microbial metabolism in diverse environments
ccs01230  Biosynthesis of amino acids
Module
ccs_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CCNA_00277
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CCNA_00277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 7330730
NCBI-ProteinID: YP_002515652
UniProt: B8GYE7
Position
290161..291321
Genome map
AA seq 386 aa AA seqDB search
MTSPAPVSVSIDPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGEIENLY
ARRGTARPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKEGVLYGRGAVDMKSAIAAFVAAV
ANVPDHPGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANLLGDMVKI
GRRGSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGYTGFQPSNLEITT
IDVGNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAAEGFDGAATALCKISGE
AFLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDE
RVPVEEVRQLAGAYEALIRRYFAAFA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccccgcgcccgtttccgtcagcatcgatcccgttgagctcgctcaagccctg
atccggcgtccgtcggtgacgccggccgacgccggcgcgatggacacgctgcagcgccaa
ctggaggcgctcgggttcgcctgccgccggatgaagttcggcgagatcgagaacctctac
gcccggcgcgggacggcgcggccgaacctctgtttcgccggccataccgatgtggtgccg
gtgggcgatgacgcggcctggaccgctgggccgttcgaggccgagatcaaggagggcgtg
ctctatgggcgcggcgcggtcgacatgaagtcggccatcgccgccttcgtcgccgccgtg
gcgaacgtccccgaccatcccggctcgatcagcttcctgatcaccggcgacgaggaagga
gtggccgaggacggcacggtcaaggtcgtcgaggccctggccgccgagggcgagatcatc
gaccactgcatcgtcggcgagccgacctcggcgaacctcttgggcgacatggtcaagatc
ggccggcgcggcagcatcaacgcctggatcaccgtcgagggccgccagggccacgtggcc
tatccgcatcgcgcggccaatccggttccggtgctggtcgacatcctgtcggccctgaag
gcgcgggtgctggacgacggctataccggcttccagccgtcgaacctggagatcaccacg
atcgacgtcggcaacaccgccaccaacgtcatccccgccgccgccaaggcgcgcgtgaac
atccgcttcaacccggcccacaagggcaaggacctggccgcctggatcgagggcgagtgc
gccaaggctgcggaaggtttcgacggcgcagccaccgcgctgtgcaagatcagcggcgag
gcgttcttgaccgagccgggcgacttcaccgacgtgatcgtggcggccgtcaccgacgcc
accggccgcgcgccggagctgtcgactaccggcggcaccagcgacgcccgcttcattcgc
gccctgtgccccgtcgtcgagttcggcctggtcggctcgaccatgcaccaggtcgatgag
cgggtcccggtcgaggaggttcgccagctggcgggcgcctatgaggcgctgatccgccgc
tacttcgcagcattcgcctaa

DBGET integrated database retrieval system