KEGG   Caulobacter crescentus NA1000: CCNA_00340Help
Entry
CCNA_00340        CDS       T00841                                 

Definition
succinyl-CoA synthetase beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_00340
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCNA_00340
   00640 Propanoate metabolism
    CCNA_00340
   00660 C5-Branched dibasic acid metabolism
    CCNA_00340
Enzymes [BR:ccs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CCNA_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
352434..353633
Genome map
AA seq 399 aa AA seqDB search
MNIHEHQAKAVLAEFGAPVPRGFAAFTPDEAAAAAEKLGGPVFVVKSQIHAGGRGKGKFE
GLGPDAKGGVRVVKSVEEVRSNAEEMLGRVLVTHQTGPKGKQVNRLYIEEGAAIAKEFYL
SLLVDRASSKVSVVASTEGGMDIEDVAHSTPEKIHTFTIDPATGVWPTHHRALAKALGLT
GGLAKEAASLLNQLYTAFMAKDMAMLEINPLIVTADDHLRVLDAKLSFDGNSLFRHPDIK
ALRDESEEDPKEIEASKYDLAYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVKGILVNIFGGIMRCDIIAEGVIAAVKEVGLQVPLVVRLE
GTNVELGKKIISESGLNVIAANDLSDGAEKIVAAVKGAR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaacatcaagccaaagctgtactcgccgagttcggcgcccccgtgccg
cgcggcttcgccgccttcacgcccgatgaagccgccgccgccgccgaaaagctgggtggg
ccggtcttcgtcgtgaagagccagatccacgccggtggccgtggtaagggcaagttcgag
ggcctgggccccgacgccaagggcggcgtccgcgtcgtcaagtcggtggaagaggttcgc
tcgaacgccgaggaaatgctgggccgcgtccttgtgacgcaccagaccggcccgaagggc
aagcaggtcaaccgcctctacatcgaagaaggcgcggcgatcgccaaggaattctacctg
tcgctgctggttgaccgcgcctcgagcaaggtctcggtcgtcgcctcgaccgaaggcggc
atggacatcgaggacgtcgcccactcgacgcccgagaagatccacaccttcaccatcgac
ccggcgacgggcgtgtggccgacgcatcaccgcgccctggccaaggctctgggcctgacc
ggcggtctggccaaggaagccgcctcgctgctgaaccagctctatacggcgttcatggcc
aaggacatggccatgctggagatcaacccgctgatcgtgacggcggatgatcacctgcgc
gtcctggacgccaagctgtcgttcgacggcaacagcctgttccgtcacccggacatcaag
gcgctgcgcgacgagagcgaagaagaccccaaggaaatcgaagcgtcgaagtacgacctg
gcctacatcgccctcgacggcgaaatcggctgcatggtcaacggcgccggtctggccatg
gccaccatggacatcatcaagctgtacggcgccgagccggccaacttcctggatgtcggc
ggcggcgccagcaaggagaaggtcaccgcagccttcaagatcatcaccgccgatccggcc
gtcaaaggcatcctggtcaacatcttcggcggcatcatgcgctgcgacatcatcgccgaa
ggcgtgatcgccgcggtgaaggaagtcggtctccaggttccgctggtcgtccgtctggaa
ggcaccaacgtcgaactcggcaagaaaatcatctcggaaagcggcctgaacgtcatcgcc
gccaacgatctgtctgacggcgccgagaagatcgtcgccgctgtgaagggcgcccgctaa

DBGET integrated database retrieval system