KEGG   Caulobacter crescentus NA1000: CCNA_00340Help
Entry
CCNA_00340        CDS       T00841                                 

Definition
(RefSeq) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_00340
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCNA_00340
   00640 Propanoate metabolism
    CCNA_00340
   00660 C5-Branched dibasic acid metabolism
    CCNA_00340
Enzymes [BR:ccs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CCNA_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
352434..353633
Genome map
AA seq 399 aa AA seqDB search
MNIHEHQAKAVLAEFGAPVPRGFAAFTPDEAAAAAEKLGGPVFVVKSQIHAGGRGKGKFE
GLGPDAKGGVRVVKSVEEVRSNAEEMLGRVLVTHQTGPKGKQVNRLYIEEGAAIAKEFYL
SLLVDRASSKVSVVASTEGGMDIEDVAHSTPEKIHTFTIDPATGVWPTHHRALAKALGLT
GGLAKEAASLLNQLYTAFMAKDMAMLEINPLIVTADDHLRVLDAKLSFDGNSLFRHPDIK
ALRDESEEDPKEIEASKYDLAYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPAVKGILVNIFGGIMRCDIIAEGVIAAVKEVGLQVPLVVRLE
GTNVELGKKIISESGLNVIAANDLSDGAEKIVAAVKGAR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaacatcaagccaaagctgtactcgccgagttcggcgcccccgtgccg
cgcggcttcgccgccttcacgcccgatgaagccgccgccgccgccgaaaagctgggtggg
ccggtcttcgtcgtgaagagccagatccacgccggtggccgtggtaagggcaagttcgag
ggcctgggccccgacgccaagggcggcgtccgcgtcgtcaagtcggtggaagaggttcgc
tcgaacgccgaggaaatgctgggccgcgtccttgtgacgcaccagaccggcccgaagggc
aagcaggtcaaccgcctctacatcgaagaaggcgcggcgatcgccaaggaattctacctg
tcgctgctggttgaccgcgcctcgagcaaggtctcggtcgtcgcctcgaccgaaggcggc
atggacatcgaggacgtcgcccactcgacgcccgagaagatccacaccttcaccatcgac
ccggcgacgggcgtgtggccgacgcatcaccgcgccctggccaaggctctgggcctgacc
ggcggtctggccaaggaagccgcctcgctgctgaaccagctctatacggcgttcatggcc
aaggacatggccatgctggagatcaacccgctgatcgtgacggcggatgatcacctgcgc
gtcctggacgccaagctgtcgttcgacggcaacagcctgttccgtcacccggacatcaag
gcgctgcgcgacgagagcgaagaagaccccaaggaaatcgaagcgtcgaagtacgacctg
gcctacatcgccctcgacggcgaaatcggctgcatggtcaacggcgccggtctggccatg
gccaccatggacatcatcaagctgtacggcgccgagccggccaacttcctggatgtcggc
ggcggcgccagcaaggagaaggtcaccgcagccttcaagatcatcaccgccgatccggcc
gtcaaaggcatcctggtcaacatcttcggcggcatcatgcgctgcgacatcatcgccgaa
ggcgtgatcgccgcggtgaaggaagtcggtctccaggttccgctggtcgtccgtctggaa
ggcaccaacgtcgaactcggcaagaaaatcatctcggaaagcggcctgaacgtcatcgcc
gccaacgatctgtctgacggcgccgagaagatcgtcgccgctgtgaagggcgcccgctaa

DBGET integrated database retrieval system