KEGG   Caulobacter crescentus NA1000: CCNA_00343Help
Entry
CCNA_00343        CDS       T00841                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CCNA_00343 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCNA_00343 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    CCNA_00343 (odhB)
Enzymes [BR:ccs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CCNA_00343 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357720..358928
Genome map
AA seq 402 aa AA seqDB search
MADINTPALGESVTEATVARWTKKVGEAVKKDEILVELETDKVSLEVASPADGVLSAIGA
AEGATVVPGTVLGVVAEGATASAAPAAAPAPKAEAPKPAPAAPAPAAAPAAAPVSPAPAR
IAAESGLDLSKVAGTGKDGRVTKGDALAALEARASAPAPAAAAAAPRALHEREERVKMTR
LRQTIARRLKEAQNSAAMLTTFNEVDMSAVMALRAQYKDVFEKQHGVKLGFMSFFVKAVV
AALKAIPDVNAEIDGQDVIYKNHYDIGVAVGTDKGLVVPVVRDADALNLAGIEKTIGDLG
KRARNGQLAIEDMQGGTFTITNGGIYGSLMSTPILNAPQSGILGMHAIKERPMVINGKIE
IRPMMYLALSYDHRIVDGAGAVTFLVKVKEAIEDPQRLLLEL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcaatacgcccgccctcggcgaatccgtcaccgaagccacggtggcgcgc
tggaccaagaaggtcggtgaggccgtgaagaaggacgagatcctcgtcgagctggaaacc
gacaaggtttcgctcgaggtggcctcgcccgccgacggcgtgctgtcggcgatcggcgct
gcggaaggcgcgaccgtcgttccgggcacggtgctgggcgtcgtcgccgaaggcgcgacc
gcctcggccgcgccggccgccgcgcccgcgcccaaggctgaagcgcccaagccggctccg
gctgccccggccccggccgcggctcccgccgccgccccggtcagcccggccccggcccgc
atcgccgccgagagcggccttgacctctccaaggtcgccggcaccggcaaggacggccgc
gtgaccaagggcgacgccctggcggctctggaagcccgcgcctcggccccggccccggcc
gccgctgcggccgcgccgcgcgccctgcacgagcgcgaagagcgcgtgaagatgacgcgc
ctgcgtcagacgatcgcccgtcgcctgaaggaagcccagaacagcgccgccatgctgacg
accttcaacgaggtcgacatgagcgcggtgatggccctgcgcgcccagtacaaggacgtg
ttcgaaaagcagcacggcgtgaagctgggcttcatgtcgttcttcgtgaaggccgtcgtc
gcggccctgaaggcgatcccggacgtcaacgccgagatcgacggtcaggacgtcatctac
aagaaccactacgacatcggcgtcgccgtcggcaccgacaagggcctggtggttccggtc
gtccgtgacgccgacgccctgaacctggccggtatcgaaaagaccatcggcgacctcggc
aagcgcgcccgcaacggccagctggccatcgaggacatgcagggcggcaccttcacgatc
accaacggcggcatctacggctcgctgatgtcgaccccgatcctgaacgcgccgcagtcg
gggatcctgggcatgcacgccatcaaggaacgcccgatggtcatcaacggcaagatcgag
atccgcccgatgatgtacctggctctgtcctacgatcaccgcatcgtcgacggcgccggc
gccgtgaccttcctggtgaaggtcaaggaagccatcgaagacccgcagcgcctgctgctg
gagctctag

DBGET integrated database retrieval system