KEGG   Caulobacter crescentus NA1000: CCNA_00358Help
Entry
CCNA_00358        CDS       T00841                                 

Definition
(RefSeq) delta 3,5-delta2,4-dienoyl-CoA isomerase precursor
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00071  Fatty acid degradation
ccs00280  Valine, leucine and isoleucine degradation
ccs00281  Geraniol degradation
ccs00310  Lysine degradation
ccs00360  Phenylalanine metabolism
ccs00362  Benzoate degradation
ccs00380  Tryptophan metabolism
ccs00410  beta-Alanine metabolism
ccs00627  Aminobenzoate degradation
ccs00640  Propanoate metabolism
ccs00650  Butanoate metabolism
ccs00903  Limonene and pinene degradation
ccs00930  Caprolactam degradation
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01120  Microbial metabolism in diverse environments
ccs01130  Biosynthesis of antibiotics
ccs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CCNA_00358
   00650 Butanoate metabolism
    CCNA_00358
  Lipid metabolism
   00071 Fatty acid degradation
    CCNA_00358
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCNA_00358
   00310 Lysine degradation
    CCNA_00358
   00360 Phenylalanine metabolism
    CCNA_00358
   00380 Tryptophan metabolism
    CCNA_00358
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCNA_00358
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CCNA_00358
   00281 Geraniol degradation
    CCNA_00358
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCNA_00358
   00627 Aminobenzoate degradation
    CCNA_00358
   00930 Caprolactam degradation
    CCNA_00358
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CCNA_00358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 7331057
NCBI-ProteinID: YP_002515733
UniProt: A0A0H3C541
Position
complement(374976..375836)
Genome map
AA seq 286 aa AA seqDB search
MSNQDQANYSCFKVEIEAGVAHIQLKRPEAMNTMTRPFWNELPAIVKDIDDNARARCIVI
SSTGKHFSAGMDLSVFTDDEGVTARQDADRWVAAESFRRFVHHLQDTFSCLDKARMPVIV
AIQGGCIGGAVDFISACDIRYATTDAFFQIQEINIGMTADVGTFPRLCKLIPEGWVRELA
YAGRRLPAQRARDIGLVNEVFDTHEEVVAHALATAREIAEKSPLAVAGSKVMINYARDHS
IADALDYIATWQTGMFSGPHMAEAFTAKAQKREAVYPDLLPLKKKM
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccaggatcaggcgaactatagctgtttcaaggtcgagatcgaggctggcgtc
gcgcacatccagctgaagcgtcccgaagccatgaacaccatgacacggccgttctggaat
gagcttcccgcgattgtaaaagatattgatgacaatgcgcgggcgcgctgcattgtcatt
tcctcgaccggcaagcatttcagcgccggcatggacctgtcggtgttcaccgacgacgag
ggcgtcaccgcccgccaggacgccgaccgctgggtggccgccgaaagcttccgccgcttc
gtgcatcacctgcaggacaccttcagctgcctggacaaggcccgcatgccggtgatcgtc
gcgatccagggcggctgcatcggcggggcggtcgacttcatcagcgcctgcgacatccgc
tatgcgaccaccgacgccttcttccagatccaggagatcaacatcggcatgaccgccgat
gtcggcaccttcccgcgcctgtgcaagctgatccccgagggctgggtgcgcgagctggcc
tatgccggccgccgcctgcccgcccagcgcgcgcgtgacatcggcctcgtcaacgaggtg
ttcgacacccacgaggaggtcgtcgcccacgcgctcgccaccgcccgcgagatcgccgag
aagtcgccgctggccgtcgccggcagcaaggtgatgatcaactacgcccgcgaccactcg
atcgccgacgcgctggactacatcgccacctggcagacgggcatgttcagcggcccgcac
atggccgaggccttcaccgccaaggcccagaagcgcgaggcggtctatccggacctgctg
ccgctgaagaagaagatgtga

DBGET integrated database retrieval system