KEGG   Caulobacter crescentus NA1000: CCNA_00445Help
Entry
CCNA_00445        CDS       T00841                                 

Definition
receiver domain-glutamate methylesterase cheBI (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCNA_00445
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CCNA_00445
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CCNA_00445
Two-component system [BR:ccs02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CCNA_00445
Bacterial motility proteins [BR:ccs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CCNA_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
451877..452911
Genome map
AA seq 344 aa AA seqDB search
MAKIRVLVVDDSATMRSLISAALNRDPDIEVVGGAGDPFEARGMIKALNPDVVTLDIEMP
NMNGIDFLEKIMRLRPMPVVMVSTLTQAGAEMTLRALELGAVDCVGKPADATGTQEALAE
IVAKVKIAARASVRTNAGAAPTSAPTRRKDFMPSGDIVAIGSSTGGVEALLSILQLFPET
CPPTVITQHMPATFTASFAARLDRSSGAKVQEASDGALLEPGKVYVAPGGATHLEVVRSA
GLRCRLVAGDPVSGHRPSVDVLFNSVAHAVGDKAVGVILTGMGRDGAQGLLTMRKAGAKT
LGQDEASCVVYGMPRSAFEIGAVERQVSLSSMGQSILDLASARR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattcgcgttcttgtcgtcgacgactccgccacgatgcggagcctgatctcg
gcggccctcaaccgtgacccggacatcgaggtggtcggcggcgccggcgacccgttcgag
gcgcggggcatgatcaaggccctgaaccccgacgtcgtgaccctcgacatcgagatgccg
aacatgaacggcatcgacttccttgagaagatcatgcgcctgcggccgatgccggtggtg
atggtctcgaccctgacccaggcgggcgcggaaatgacgctgcgggccctggagctgggc
gcggtggactgcgtcggcaagcccgccgacgccaccggcacccaggaagccctggccgag
atcgtcgcgaaggtgaagatcgccgcccgcgcctcggttcgcacgaacgccggcgcggcg
ccgaccagcgcgcccacgcgccgcaaggacttcatgccctcgggcgacatcgtggcgatc
gggtcgtcgaccggcggggtggaagccctgctgtcgatcctgcaactgttccccgagacc
tgtccgccgaccgtcatcacccagcacatgccggccaccttcacggccagcttcgccgcc
cgcctcgatcgttcgagcggcgcgaaggtgcaggaggcttccgacggcgctttgctggag
cccggcaaggtgtacgtggcgccgggcggcgcgacgcacctcgaagtcgttcgctcggcg
ggcctgcgttgccgtctggtcgcgggcgaccccgtgagcgggcaccgcccctcggtggac
gtgctgttcaactcggtggcgcacgccgtcggcgacaaggcggtgggggtgatcctgacc
ggcatgggccgcgacggcgcccagggcctgctgacgatgcgcaaggccggcgccaagacg
ctgggccaggacgaagcaagctgcgtcgtctacggcatgccccgatccgctttcgaaatc
ggcgccgtggagcgacaggtcagcctgtcctcgatgggccagtccatcctcgatttggcc
tccgcgaggcgatag

DBGET integrated database retrieval system