KEGG   Caulobacter crescentus NA1000: CCNA_00487Help
Entry
CCNA_00487        CDS       T00841                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCNA_00487
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CCNA_00487
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCNA_00487
Enzymes [BR:ccs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CCNA_00487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
504911..506605
Genome map
AA seq 564 aa AA seqDB search
MTIDRRRLLGLLGVSGAAAGEAAAQPISYFKGPVAFEHGVASGDPGLTYVIFWTRVTPKQ
ATTGDVDVDLEVAADPDFKTLVTASRGLRARASRDWTVKHDLDGQGLKPGTEYWYRFKAN
GVTSPVGRTKTLVKGAAKDAVLAVVSCSLYPNGYFNAYDAIAKLPRVDAVVHLGDYIYEY
GGAPQDYGMNSPVAKSRTPEPPHEIVTLDDYRRRHAQYKTDPALQAAHARAPWIVAWDDH
ETANDSWVGGAENHDPDKGEGDWTARKAAALKAYYEWMPIREAALPEAAWRSFQFGDVAS
LLMVETRLTARTPELSYDRDMPIVDGKPDVAAFVAKWKDPSRRMMGEGQEQWLAGQVGAS
VQAKTAWQVLGNQVVMARVASANLKATMGEAAYGDLQAKLPEYARKRVDQSVAMSAFDVP
SNLDAWDGYPADRQRVYDIFTAAKARPIVLAGDSHMFWANELWNDAGQKRVAVEFGTTSV
TSPGYGDYLPGVPIGEAFVQRNKEVKYAHPSAKGFVLLTLEHGKATSELMAVSTIMKPTY
ELAAMKRFVVTPSADGGVEALREA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgatcgtcgcagactgttgggcttgctgggcgtttcgggcgccgccgccggt
gaggccgccgctcaaccgatcagctacttcaagggccccgtcgcctttgagcacggcgtg
gccagcggcgatccgggccttacctatgtgatcttctggacccgtgtgacgccaaagcag
gcgaccaccggcgacgtcgacgtcgatcttgaagtcgccgccgacccggatttcaagacc
ctggtcaccgccagccgcggccttcgcgcccgcgccagccgcgactggaccgtcaagcac
gacctggatggccaggggctcaagccggggaccgagtactggtaccgcttcaaggccaat
ggggtcacctcgccggtcggtcggaccaagacccttgtgaagggcgcggccaaggacgcg
gtgctggcggtggtctcctgcagcctctatccgaacggctacttcaacgcctacgacgcc
atcgccaagctgccgcgcgtcgacgccgtcgtgcatctgggcgactacatctacgagtat
ggcggcgcgccgcaggactacggcatgaactcgccggtggcgaagtcccgcacgcccgag
ccgccgcacgagatcgtcaccctggacgactatcgtcgccgccacgcgcagtacaagacc
gatccggctctgcaggccgcccacgcgcgcgcgccgtggatcgtggcttgggacgatcat
gagaccgccaacgacagctgggtcggcggcgccgagaaccatgatcccgacaagggcgag
ggcgactggacggcccgcaaggccgccgccctgaaggcctattacgagtggatgcccatc
cgcgaagcggccctgccggaggcggcctggcggtcgttccagttcggcgacgtcgcgtcc
ttgctgatggtcgagacccggctgaccgcccgcacccccgagctgagctacgaccgggac
atgccgatcgtcgatggcaagcctgatgtcgcggccttcgtggccaagtggaaggatccg
tcgcgccggatgatgggcgagggacaggaacagtggctggccggccaggtcggcgcctcg
gtgcaggccaagaccgcctggcaggttctgggcaaccaggtggtgatggcgcgcgtcgcc
tcggccaacctgaaggccaccatgggcgaggcggcctatggcgacctgcaggccaagctg
ccggaatacgcgcgtaagcgggtggatcagtcggtggcgatgtcggccttcgacgtgccg
tccaatctggacgcctgggacggctatccggccgatcgccagcgggtctacgacatcttt
acggccgccaaggcgcgtccgatcgtgctggcgggtgacagccacatgttctgggccaac
gaactctggaacgacgcgggccagaagcgcgtggcggtcgagttcgggaccacctcggtc
acctcgcccggctatggcgactacctgcccggcgtgccgatcggcgaggccttcgtgcag
cgcaacaaggaagtgaagtacgcccaccccagcgccaagggcttcgtgctgctgacgctc
gaacacggcaaggcgaccagcgagctgatggcggtctccaccatcatgaagccgacttac
gagctggctgcgatgaagcgcttcgtggtcacgccctcggctgacggcggggtggaggcg
ctgcgcgaggcctag

DBGET integrated database retrieval system