KEGG   Caulobacter crescentus NA1000: CCNA_00633Help
Entry
CCNA_00633        CDS       T00841                                 

Gene name
cheBII
Definition
receiver domain-glutamate methylesterase CheBII (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ccs02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ccs02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679391..680467
Genome map
AA seq 358 aa AA seqDB search
MSAAVAATAHPVRVMIVDDSAVVRGMVTRWLEEAGFIIAAIAVDGGQALRKLADTSVDVC
LLDIEMPVMSGLEALPKLLAAKPDLRVIMASTLTERGAEVTLRALDLGAADYIAKPSANK
LGGADLYRKDLIEKVRHLGARAARPAPPQAAPRPTLAPPSSDPAGPIEAVVVASSTGGPP
ALRRFIAGLGADWTSPILIAQHMPPGFTRTLAQMLDPISHLTAREAQNGEPIVPGVIYVA
PGDYHMTVRAAGGGGPSIHLDQGPEVNYCRPSADPLFESAARFWKGRVLGVVLTGMGRDG
RDGAAVLAKVGGTIIAQDEATSVVWGMPGAVANAGLAEAVLPLDQIGPYIASRARSVA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccgtcgcggcgacagcccatcccgtgcgggtcatgattgtcgacgactcc
gccgtggtccgcgggatggtcacgcgctggcttgaggaggcgggcttcatcattgcggcc
atcgccgtcgatggcggtcaggcgctgcgcaagctggcggacacctcggtcgacgtctgc
ctgctggacatcgagatgccggtgatgtcgggcctcgaggcgctgcccaagctcttggcg
gccaagcccgacctcagggtcatcatggcctcgaccctgaccgagcgtggggccgaagtc
acgctgcgggcgcttgatctgggggcggccgactacatcgccaagccctcggccaacaag
cttggcggcgctgatctgtaccggaaggacctgatcgagaaggtccgtcacctcggcgcg
cgcgccgcgcggcccgcgccgccccaagccgcgccgcgtccaacgctagccccgccctcg
tcggaccccgccggaccgatcgaggccgtggtggtggcgtcctccacaggaggccccccg
gcgctgcgtcgctttatcgccgggctcggcgcggactggacgtctcccattctgatcgcc
caacacatgccgcccggcttcacccgcaccctggcgcagatgttggaccccatatcgcat
ctgacggcccgcgaggctcagaacggcgagcccatcgtgcccggcgtgatctatgtcgcg
cccggcgactaccacatgaccgtccgtgcggccggcggcggcggtcccagtatccatctg
gatcaaggacccgaggtcaactattgccgcccttcggctgaccctctgttcgagtccgcc
gcgcggttctggaaaggccgtgtgctgggggtcgtgctgacgggcatgggacgcgacggg
cgcgatggcgcggccgtcctggccaaggtcggcgggacgatcatcgctcaggatgaggcg
accagcgtcgtctggggcatgcccggggcggtcgccaacgccggtctcgccgaagctgtt
ttgccgctggatcagatcggcccctatatagcgtcaagagcccggagcgtggcgtga

DBGET integrated database retrieval system