KEGG   Caulobacter crescentus NA1000: CCNA_00657Help
Entry
CCNA_00657        CDS       T00841                                 

Definition
type I restriction-modification system specificity subunit
Orthology
K01154  
type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
ccs  Caulobacter crescentus NA1000
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712528..713880
Genome map
AA seq 450 aa AA seqDB search
MSFPAYESYKESGVEWLGRVPSHWNFRPLKHLVIMRSGGTPSKEREDYWGGEIPWASAKD
LKVDTLTDTQDHLTAEALDEGAAQLLPANAVVVLVRGMMLARTFPVCRLSRPMTINQDLK
GLIANRGVDPNYLAWSLRASEVETLCRLDEAGHGTKALRMDAWSTMELPAPSLAEQQAIA
AFLDRETAKIDALVEAQERLIALLKEKRQAVISHAVTKGLDPSAQMKDSGVEWLGQMPAH
WEVVPAKNLADSIKAGPFGSALTKDMYSSAGYRVYGQEQVIPGDFRIGDYYVTSDRYNEL
SQYRVEVGDLLVSCVGTFGKIAIFPQGAEPGIINPRLIRFRPNNQVDPTYLCVLLRSAVS
FEQFSYLSRGGTMDVINIGILGEIVVPVPPMQEQISIAGYLAEVQEQFDSLSAASEAAIT
LLQERRAALISAAVTGKIDVRGLVQTAEAA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgagctttccggcttatgagagctataaggagagtggggtcgagtggctcgggcgggtg
ccgagccattggaattttcggccgctaaagcacctcgtaatcatgcggagcggcggcacg
ccaagcaaggaacgagaagactattgggggggagaaattccttgggcatcggccaaggac
ctaaaggtcgacaccctgaccgatactcaggaccaccttacggcggaagctctcgatgaa
ggtgctgctcagcttctccccgctaacgccgtcgtggtgctcgttcgcgggatgatgctc
gcccggactttcccagtttgtagattgtcgcggccaatgacgatcaaccaagacctgaag
gggctcatagctaaccggggcgttgaccccaactatctggcttggtcgcttcgggcatca
gaagtcgagactctttgccggctcgatgaagccggacacggcaccaaagcgctaaggatg
gacgcctggtccacaatggaattgcctgcgccgtctttggcggagcagcaggccatcgcc
gccttccttgaccgggagaccgccaagatcgacgcgctggtggaggcgcaggagcggctg
atcgcgctgctgaaggagaagcgacaggccgtcatctcccacgccgtcaccaaggggctc
gacccgtccgcccagatgaaggacagcggcgtcgaatggctcggccagatgccggcgcat
tgggaggtggtgcccgccaagaacctcgccgacagcataaaagccgggccatttggctca
gcgctcactaaagatatgtattcaagcgccggataccgcgtctatggccaagaacaagtt
ataccaggagactttagaatcggcgactactacgtaacgagcgatagatacaatgaactt
tctcagtatcgcgtcgaggtcggcgaccttcttgttagctgcgtaggaacattcgggaag
atcgcaattttcccgcagggggcagagcccgggatcatcaatccgcggctaatacgcttt
aggccgaacaatcaggtcgatccgacatatttatgcgtcctgctccgaagcgcagtttcg
ttcgagcagttttcgtatctcagccgcggaggcacgatggacgtaatcaacatcggcatc
ctcggcgagattgtggttccagttccgcctatgcaggaacaaatcagtatcgccggttat
ctcgccgaggttcaggagcagtttgacagcctctccgccgcctcggaagccgccatcacc
ctccttcaagaacgccgcgccgccctgatctccgccgccgtcaccggcaagatcgacgtg
cggggcctcgtccagacagcggaggccgcatga

DBGET integrated database retrieval system