KEGG   Caulobacter crescentus NA1000: CCNA_01001Help
Entry
CCNA_01001        CDS       T00841                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CCNA_01001
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CCNA_01001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1083029..1083940)
Genome map
AA seq 303 aa AA seqDB search
MTVFVLGSINLDAVARVDDLPRPGETVAGLSLELFLGGKGANQAVAAARMGVATRLMGAV
GGDDSGAGLKAKLAGYGVQVGDVVELPGVPTGQAHVWVANSAENMIVVTAGANAMVTPQQ
VAATTIEGQRVLLCQLETPATAIETLFRAGSAKGALRILNAAPALPQGAALFPLTDILIV
NQTELATYAKLDREPVKLEEVSVAARKLMSRPDQTIIVTLGAAGAAVVRRDEAFLVEGKK
VKAVDTVGAGDCFCGALAATLAAGMDLAEAVETANAAAALSVQKAGAAPSMPNRREVEAF
LEG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttttcgttctcggctcgatcaatctggacgccgtggcgcgcgtcgacgatctg
ccccgccccggggaaaccgtcgcgggcctgtcgctggagctgtttctgggcggcaagggc
gccaaccaggccgtcgccgccgcccgcatgggcgtggccacccgcctgatgggggcggtc
ggcggcgacgacagcggcgccggcctgaaagccaagctggccggctatggcgtgcaggtc
ggcgacgtggtcgaactgccgggcgtgcccacaggccaggcccatgtctgggtcgccaac
agcgccgagaacatgatcgtggtgaccgccggcgccaacgccatggtcacgccccagcag
gtggccgccacgacgatcgagggccagcgggtgctgctctgccagctcgagacgccggcc
acggcgatcgagaccctgttccgcgccggctcggccaagggcgccctgcggatcctgaac
gccgccccggccctgcctcagggcgcggcgctgttcccgctgaccgacatcctgatcgtc
aaccagaccgaactggccacctacgccaagctcgaccgcgagccggtcaagctggaagag
gtctcggtcgccgcccgcaagctgatgagccgccccgaccagaccatcatcgtcacgctc
ggcgcggccggcgcggccgtggtgcggcgcgacgaggccttcctggtcgagggcaagaag
gtcaaggcggtcgacaccgtcggggccggcgactgcttctgcggcgccctggccgccacc
ctggccgccggcatggacctggccgaggccgtcgagacggccaacgccgccgccgccctt
tccgtccagaaagccggcgccgcgccgtcgatgccgaaccgccgcgaggtcgaggcgttt
ctggaggggtga

DBGET integrated database retrieval system