KEGG   Caulobacter crescentus NA1000: CCNA_01268Help
Entry
CCNA_01268        CDS       T00841                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ccs00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ccs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1396765..1397271)
Genome map
AA seq 168 aa AA seqDB search
MRSLNLAAVAALCVIVSACSKDGGSSSQAPADAPTPAAAPAPTDAEKAAALAALPAPYNT
GDLSNGQSKFALCRSCHTITEGGPDLTGPNLYGVFGRKAGVKEGYSFSDAVKAAGFIWDA
QQLDKWLADPRGFMPGTKMTFAGIKNEKDRIDLIAYLKVETGYQTPAK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgttgaacctggccgccgtcgcggccctctgtgtgatcgtttcggcctgctcg
aaggatggcggcagctccagccaggcccccgccgacgcaccgacgccggctgcagcgccc
gcgcccaccgacgccgagaaggccgccgccctcgccgccctgcccgcgccctacaacacc
ggcgacctgtccaacggccagagcaagttcgcgctctgccgctcgtgccacaccatcacc
gaaggcggaccggacctgacgggtccgaacctgtacggcgtcttcggtcgcaaggccggc
gtcaaggaaggctacagcttctccgacgctgtgaaggcggccggcttcatctgggacgcc
cagcaactcgacaagtggctggccgatccgcgcgggttcatgcccggcaccaagatgacc
ttcgccggtatcaagaacgagaaggatcgcatcgacctgatcgcctatctgaaggtcgag
acgggctaccaaacgccggcgaaatag

DBGET integrated database retrieval system