KEGG   Caulobacter crescentus NA1000: CCNA_01281Help
Entry
CCNA_01281        CDS       T00841                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CCNA_01281 (glpK)
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CCNA_01281 (glpK)
Exosome [BR:ccs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCNA_01281 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1407064..1408554
Genome map
AA seq 496 aa AA seqDB search
MAQDLILALDQGTTSTRAILFDRAGTALGDASRPLRQSYPADGWVEHDAEEIYAAAVAVL
REVTEASGRMADIAAIGVTNQRETVVVWDRATGRPIHPAIVWQDRRTADVCARLKAEGHE
PRVTEVTGLLLDPYFSATKIAWILDKTPGARARAEAGELLCGTMDCWVIWRLTGGAVHAT
DATNASRTLLFDIGAQAWSSEMLALFNVPSTILPKVLDCVDDYGATQADILGREVPIRGV
AGDQQAALMGQGCVAPGQMKATYGTGCFMLINTGTDRAVSRARLLTTVAARVGGKTTYAL
EGSIFVAGAAIQWLGEGLGITGGPRAAEALARAAKPDHAVVVVPAFTGLGAPWWDAEARG
GIFGLTRDAGLPEIAAATFDACALQSRDLIEAMRADAPTAFGEAAQLRIDGGMAKSAWFS
QRLADLTGLSVRRASYQETTALGAALFAAVGAGLYGSIEEAAEASPAAETLAPAMDDHVR
EAAYARWLDAVPRVRL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagacctgatcctggccctggaccagggcaccaccagcacgcgcgccatcctg
ttcgatcgggcggggacggccctgggcgacgcctcgcgtcctctgcgtcaaagctatccg
gccgacggctgggtcgagcatgacgccgaggagatctacgccgccgccgtcgctgtgctg
cgcgaggtcaccgaggcctccgggcggatggcggacatcgctgcgatcggcgtcaccaac
cagcgcgagaccgtggtcgtctgggatcgggctacgggccgtccgatccatccagccatc
gtctggcaggatcgccgcaccgctgacgtctgcgcgcgcctcaaggccgaggggcatgag
ccgagggtgaccgaggttacgggcctgctgctcgacccctatttctcggcgaccaagatc
gcctggatcctcgacaagacacccggcgccagggcccgggcggaggccggcgagcttttg
tgcggcaccatggactgctgggtgatctggcgactgacgggtggcgccgtgcacgcgacc
gacgccaccaacgcttctcgaaccttgctgttcgatatcggcgctcaggcctggtcgagc
gagatgctggcgttgttcaatgtgccctcgacgatcctgcccaaggtgctggactgcgtc
gacgactatggcgcgacgcaggccgacatcctgggccgcgaggtccccattcggggcgtg
gcgggcgatcagcaggcggcgctgatggggcagggctgtgtcgctccgggccagatgaag
gccacctacggcaccggctgcttcatgctgatcaatacggggactgaccgcgccgtctcg
cgggcgcgcctgttgaccaccgtcgcggcgcgggtcggcggcaagacgacctacgcgctg
gaagggtcgatcttcgttgcaggcgcggcgatccagtggctgggcgaggggctcggaatc
acgggcggtccccgcgccgctgaggcgctggcccgggcggccaagccggatcacgcggtg
gtggtggttcccgcgttcacgggtcttggcgccccctggtgggacgccgaggcgcggggt
gggatcttcggtctgacgcgcgatgcaggactacccgagatcgccgccgccaccttcgac
gcctgtgcgctgcagagccgcgacctgatcgaggcgatgcgcgccgatgcgcccacggcc
tttggcgaagcggcgcaactgcggatcgacggcggtatggccaagagcgcctggttctcg
cagcggctggccgatctcacggggctctcggtgcgccgcgccagctatcaggagaccacg
gccctgggggcggcgttgttcgccgccgtcggcgcgggtctctacgggtcgatcgaagag
gccgccgaagccagtccagccgccgagaccttagcgccggccatggacgaccatgtgcgg
gaagccgcctacgcccgttggctcgacgcggtgccgcgcgttcgactttag

DBGET integrated database retrieval system