KEGG   Caulobacter crescentus NA1000: CCNA_01378Help
Entry
CCNA_01378        CDS       T00841                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ccs  Caulobacter crescentus NA1000
Brite
Enzymes [BR:ccs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CCNA_01378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492535..1493107
Genome map
AA seq 190 aa AA seqDB search
MSTDFAAARLNMVESQIRTADVTDLPLQDALRVVARESVVPASKAYLAYADADIEYAPGR
WLLRPREVGKLLQALKPREGETVLAIAAPYAAAVLEKMGLSVTRHDGEDLKTVPAGAYDV
IVCEGAVAVAPKSWQDALAHGGRLGVVERTGPVGRAAIYLRAEDGVGRRAAFDASPPLLA
GFEAETGFSF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacttcgccgccgcgcggctgaacatggtcgagagccagattcgcaccgcc
gacgtgaccgatctgccgctgcaggacgcgctgcgcgtcgtggcgcgcgagagcgtcgtg
ccggcctcgaaggcctatctggcctatgccgacgccgacatcgagtacgcccccggtcgc
tggcttctgcgcccgcgtgaggttggcaagctgctgcaagcgctgaagccgcgcgaaggc
gagaccgtcctggccatcgctgcgccctatgcggccgccgtcctggaaaagatgggtctt
tcggttacgcgccacgatggcgaggacctgaagacggtccccgccggcgcttacgatgtc
atcgtatgcgaaggcgccgtcgccgttgcgcccaagagctggcaggacgccttggctcat
ggcggtcgcctgggcgttgtcgagcgtacgggtcctgtggggcgcgccgcgatttatctg
cgcgccgaggacggcgtcggccgtcgcgccgcgttcgacgcttcgccgccgctgctcgcc
ggcttcgaggctgagacgggcttcagcttctga

DBGET integrated database retrieval system