KEGG   Caulobacter crescentus NA1000: CCNA_01397Help
Entry
CCNA_01397        CDS       T00841                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ccs00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1516960..1517832
Genome map
AA seq 290 aa AA seqDB search
MRLSAFAPAKVNLFLHVGGPDGEGYHPISSLMVFADVGDRVNLQPADAPAFETSGPFGDQ
IPAGGDNLVVRAGQAFHRRLGGPVPPYRLILEKHLPIAAGLGGGSSDAGAALKLLRDALA
PALSDDDLEALAASLGADGAACLRARALIAEGRGERLSPAPRLPELNAVLVNPGAPSPTG
AVYRAYDAGVHPDGAAMPPMPDHLESAEEAAAWLAFATRNDLEAPAVRLEPHIGEVLDVL
RGEPESLLVRMSGSGATCFALCASDIEAEGLAERLETMRPDWWVRRCRLS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtcagcgttcgccccggccaaggtcaatctgttcctgcatgtcggcgggccg
gacggggagggctatcatccgatctccagcctgatggtgttcgccgatgtcggcgaccgg
gtgaacctccagcccgccgacgcgccggcgttcgagacgtccgggccgttcggggatcag
attcccgccggcggcgacaatctggtggtccgcgcaggccaggctttccacaggcggctc
ggcggtccggttccgccttatcggctgatcctggagaagcacttgccgatcgctgcgggc
ctgggcgggggctccagcgacgcgggtgcggcgctcaagctgttgcgtgacgccctggcc
ccggcgctttccgatgacgatctggaggcgctggctgcgagccttggcgcggacggcgcg
gcctgtctgcgcgcgcgcgcccttatcgcagaagggcgaggcgagcggctgtcgccggcg
ccgcggttgcccgagttgaacgcagtgctggtcaatcccggcgcgccgtcgccgaccggc
gcggtctatcgcgcctatgacgcgggcgtgcacccagacggcgccgccatgccccccatg
cccgaccatctggagagcgctgaggaggccgccgcctggttggcctttgcgacacgcaac
gacctggaggcgccggccgtgaggcttgagccgcacatcggcgaggtgctggacgtgctg
cggggcgagccggaaagtctgctggtccgcatgtcgggttcgggtgcgacctgtttcgcg
ctctgcgccagcgatatcgaggccgaaggtctggccgagcgcctggagacgatgcgtccg
gactggtgggtgcggcgctgccgcctgagctga

DBGET integrated database retrieval system