KEGG   Caulobacter crescentus NA1000: CCNA_01409Help
Entry
CCNA_01409        CDS       T00841                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
ccs00860  Porphyrin and chlorophyll metabolism
ccs01100  Metabolic pathways
ccs01110  Biosynthesis of secondary metabolites
ccs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCNA_01409
Enzymes [BR:ccs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CCNA_01409
Exosome [BR:ccs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCNA_01409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 7330138
NCBI-ProteinID: YP_002516782
UniProt: A0A0H3C809
Position
complement(1526556..1527560)
Genome map
AA seq 334 aa AA seqDB search
MTTPPLAPYPHTRLRRVRQSDWVRRLVRETEVRPSDLIWSMVVHEGEGTIPVASMPGVER
LSVKEAAKAAVRARDLGIPAIAIFPHIDGSRKDAAGSIAADPDGVIPRAVKAMKDAAPEV
GIMCDVALDPFTDHGHDGVVEGGKILNDATIERLIEQGLMQADAGADILAPSDMMDGRIG
KLRAALEGANYQDVMIMSYAAKYASAFYGPYRDAIGSAKLSAGQGDKKTYQMDPANTEEA
IREVALDIAEGADMVMVKPGMPYLDILRRLVEEFRMPTYAFQVSGEYAMIMAAAQNGWID
KDRAILESLTAFKRAGAAGIITYFAPWAAEKLGA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccgcccctcgccccctatccgcacacccgcctgcgccgcgtgcgccagagc
gactgggtccgtcgcctggtccgcgagaccgaggttcgcccgtccgacctgatctggtcg
atggtggtgcacgagggcgaaggaaccatcccggtggcctccatgcccggcgtcgaacgc
ctgtcggtgaaggaagccgccaaggccgccgtccgcgcccgagatctgggcatcccggcc
atcgccatcttcccgcatatcgacgggtcgcggaaagacgcggccggctcgatcgccgcc
gatccggacggggtgatcccccgcgcggtcaaggccatgaaggacgccgcccccgaggtc
gggatcatgtgcgacgtggcgctggaccccttcacggaccacggccacgacggcgtggtc
gagggcggcaagatcctcaacgacgccacgatcgagcgcctgatcgaacagggcctgatg
caggccgatgccggcgccgacattctggcgccgtccgacatgatggacggccgcatcggc
aagctgcgcgccgcgctggaaggcgcgaactatcaggacgtgatgatcatgtcctacgcg
gccaaatacgcctcggccttctatggcccgtaccgcgacgccatcggctcggccaagctg
tcggccggccagggcgacaagaagacctaccagatggacccggccaataccgaggaagcc
atccgcgaagtcgccctcgacatcgccgagggcgccgacatggtcatggtcaagccgggc
atgccttatctggacatcctgcgccgcctggtcgaggagttccgcatgcccacctacgcc
ttccaggtgtcaggcgagtacgcgatgatcatggccgccgctcagaacggctggatcgac
aaggaccgcgccatcctggaaagcctgaccgccttcaagcgcgccggcgcggccgggatc
atcacctatttcgcaccctgggcggcggagaagctgggggcttga

DBGET integrated database retrieval system