KEGG   Caulobacter crescentus NA1000: CCNA_01499Help
Entry
CCNA_01499        CDS       T00841                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCNA_01499
   00630 Glyoxylate and dicarboxylate metabolism
    CCNA_01499
   00640 Propanoate metabolism
    CCNA_01499
   00650 Butanoate metabolism
    CCNA_01499
  Lipid metabolism
   00071 Fatty acid degradation
    CCNA_01499
   00072 Synthesis and degradation of ketone bodies
    CCNA_01499
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCNA_01499
   00310 Lysine degradation
    CCNA_01499
   00380 Tryptophan metabolism
    CCNA_01499
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCNA_01499
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCNA_01499
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCNA_01499
Enzymes [BR:ccs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCNA_01499
Exosome [BR:ccs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCNA_01499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1609534..1610736
Genome map
AA seq 400 aa AA seqDB search
MPQGIRDKVAILGMGCSKFGERWDAGPDDLMVEAYLEAMQDAGIEPTQLDAAWFSTHIDE
IGSGKGGTPLSIALRLPNIAVTRVENFCASGSEAFRGAVYAVAAGAADIALAVGVEKLKD
TGYGGLPVANPGTLSPQVMPNGSAPGNFAQLASAYRAKHGVSKEDLKRAIAHVSVKSHAN
GAKNPKAHLRKPITEEQALSAPLIAEPLGLFDCCGVSDGAAAAIVTTPEIARALGKHDLV
TVKALQLSVSNGYESQYNGWDGSHFHTARIAAGKAYREAGIERPREQISMMEVHDCFSVT
ELVTMEDLFISPEGQGWRDVLDGFYDADGGVPCQIDGGLKCFGHPIGASGLRMLYEMYLQ
LQGRAGERQLANPVFGMTHNLGGAPASNVCSVAIIGQEGA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaggtatccgcgacaaggtcgccattctcgggatgggctgttcgaagttcggc
gagcgctgggacgccggccccgacgacctgatggtcgaagcctatctggaggctatgcag
gacgccggcatcgagccgacccagctggacgccgcctggttctccacccacatcgacgag
atcggctcgggcaagggcggcacgccgctgtcgatcgccctgcgcctgcccaacatcgcc
gtcacccgcgtcgagaacttctgcgcctcgggctcggaagccttccgcggggcggtctac
gccgtggcggccggcgcggccgacatcgccctggcggtcggggtcgagaagctgaaggac
accggctatggcggcctgccggtcgcaaatcccggtacgctgagcccgcaggtgatgccc
aatggctcggcccccggcaacttcgcgcaactggccagcgcctatcgcgccaagcacggc
gtctccaaggaagacctcaagcgcgccatcgcccacgtttcggtcaagagccacgccaac
ggcgccaagaaccccaaggcccacctgcgcaagccgatcaccgaggagcaggcccttagt
gcgccgctgatcgccgagccgctgggcctgttcgactgctgcggcgtgtcggacggcgcg
gcggcggccatcgtcaccacgcccgagatcgcccgggccctgggcaagcacgacctggtc
acggtcaaggcgctgcaactgtcggtctcgaacggctatgagagccagtacaacggctgg
gacggcagtcacttccacaccgcccgcatcgctgcgggcaaggcctatcgcgaggccggc
atcgagcggccgcgtgagcagatctcgatgatggaggtgcacgactgcttctcggtcacc
gagctggtgacgatggaggacctgttcatctcgccggaggggcagggctggcgcgacgtg
ttggacggcttctacgacgccgacggcggcgtgccgtgccagatcgacggcggtctcaag
tgcttcggccaccccattggcgcgtccggcctgcggatgctctacgagatgtacctgcag
ctccaaggtcgcgccggcgagcggcaactggccaacccggtgttcggcatgacccacaac
ctgggtggcgcgccggccagcaacgtctgctcggtcgccatcatcggccaggaaggggct
taa

DBGET integrated database retrieval system