KEGG   Caulobacter crescentus NA1000: CCNA_01620Help
Entry
CCNA_01620        CDS       T00841                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCNA_01620
Enzymes [BR:ccs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CCNA_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1741064..1741558
Genome map
AA seq 164 aa AA seqDB search
MIVALGCNLPGAYTSREALLEAAVAALPQVGLEVVTRSGWWTSAAWPDPAGPAYLNGVAV
VRTTLSPRQVLDALHSLEARFGRARGEANAPRTLDLDLIAHGRTVLDDGLVVPHPRAHQR
LFVMGPLSELYSGWIHPVTGEPAFRLAATATVGRDARPMAAPTA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtggcgctcggctgcaatctgcccggagcctatacgagtcgcgaggccttgttg
gaagccgccgtggcggcgctgccgcaggtcgggctggaggtggtgacgcggtcgggctgg
tggacctccgccgcttggcctgacccggcggggcccgcgtatctgaacggcgtggcggtc
gtgcggacgacgctctcgccgcgtcaggtcctggacgcgctgcattcactggaggcgcgg
ttcgggcgggcgaggggagaggccaatgcgccgcgcactctggacctggatctcatcgcc
catggccgcacggtgttggacgatggcctggtggtgccgcatccgcgcgcccaccagcgg
ctgtttgtgatggggccgctttcggagctgtattctggctggattcaccctgtcaccggc
gagccggcctttcgcctggcggcgaccgcgacggtcggccgcgatgcgcgaccaatggcg
gcgccgacggcctag

DBGET integrated database retrieval system