KEGG   Caulobacter crescentus NA1000: CCNA_01636Help
Entry
CCNA_01636        CDS       T00841                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ccs00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ccs00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ccs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1754218..1755804
Genome map
AA seq 528 aa AA seqDB search
MSVLDRYALSRRRMLAVFGGAAVSAMAIPLESGKALAQAVFQTYPFQLGVASGDPSSDGF
VIWTRLAPEPLEIGYGMPSAPVAVEWEVGDAPNMRNIVAKGTAIAPPELGHAVHVEVGGL
QPNRDYWYRFTAGRERSLLGRARTTPALGAALERVRFAVAGCQHYEQGYYTAYRRLAEEN
PDFVFCYGDYIYEYRGNRVWNSASGPVENVRQHFGGEIYSLDDYRRRYAQYKMDTDLQAA
HAAAPWFTVWDDHEIDNNWVTDLDQDGVDPKIFNLRRQAAVQAYYENMPLRASSFPTGTS
LQIYRRATYGQLLNLNLLDTRQYRTDQPCGDRFGYCDAVEASRAEVIGQVQEKWLTNGLI
ESKSTWNVLAQQIMMMDLDREPGEGKAVNPDSWAGYRMPRNRLLQTIRDRKVGNVVVLTG
DEHQNYAGDLYLDGAKAEGAPIASEFVVTSISSGGDGVDQRADMARIQAANPILKFNNAQ
RGYALCDVTPKAFVTEFKVLDAITRRDGKLSTRAKWALEAGKTGIVQA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcctcgatcgctacgccctgagccgtcgtcgcatgctggcggtgtttggcggg
gccgctgtgtccgccatggcgatcccgctggagagcggcaaggccctggctcaggcggtg
ttccagacctatccgttccaactgggcgtggcctccggcgacccgtcgtcggatggcttt
gtgatctggacgcgtctggcgcccgagccgctcgagatcggctacggcatgccgtccgcg
ccggtcgccgtcgaatgggaagtcggtgacgcgcccaacatgcgcaacatcgtggccaag
ggcacggccatcgcgccgccggagctgggccacgcggtccacgtcgaagtcggcggcctg
cagcccaatcgggactactggtatcgcttcaccgccggacgggagcgcagcctgctgggc
cgggcccgcacgacgccggcgctgggcgcggcgctggagcgcgtgcgcttcgcggtggcc
ggctgccagcactacgagcagggctactatacggcctatcgccgtctggccgaagaaaac
cccgacttcgtcttctgctacggcgactacatctacgagtatcgtggcaaccgggtctgg
aacagcgccagcggtccggtggagaacgtgcgccagcatttcggcggcgagatctacagc
ctcgacgactatcgccgccgctacgcccagtacaagatggacaccgacctgcaggccgcc
cacgcggctgcgccgtggttcacggtctgggacgaccacgagatcgacaacaactgggtc
actgacctcgaccaggacggcgtcgatcccaagatcttcaacctgcgccgtcaggccgcc
gtccaggcctattacgagaacatgccgctgcgggcctcgagcttcccgaccggcacgtcg
ctgcagatctatcgccgggcgacctatggccagctcttgaacctgaacctgctggatacg
cgccagtatcgcaccgaccagccctgcggcgaccggttcggctactgcgacgcggtggag
gcttcgcgcgccgaggtcatcggccaggttcaggaaaagtggctgaccaacgggctgatc
gagtccaagtcgacctggaacgtgctggcccagcagatcatgatgatggacctcgaccgc
gagccgggcgagggcaaggcggtcaatccggactcgtgggccggctatcgcatgccgcgc
aatcgcctgctgcagaccatccgcgaccgcaaggtcggcaatgtcgtggtgctcaccggc
gacgagcaccagaactatgccggcgatctctatctcgacggcgccaaggccgaaggggct
ccgatcgcctcggagtttgtcgtcacctcgatcagctccggcggcgacggggtcgaccag
cgcgccgacatggccaggatccaggccgccaacccgatcctcaagttcaacaacgcccag
cgcggctatgcgctctgcgacgtgacgcccaaggcgttcgtgaccgagttcaaggtgctg
gacgcgatcacccgccgggacggcaagctgtcgactcgggccaaatgggcgctggaagcc
ggaaagacggggatcgttcaggcctaa

DBGET integrated database retrieval system