KEGG   Caulobacter crescentus NA1000: CCNA_01704Help
Entry
CCNA_01704        CDS       T00841                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ccs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CCNA_01704
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCNA_01704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1836139..1836501
Genome map
AA seq 120 aa AA seqDB search
MMKVRLTLAAVFAALASGAVAAPSGQQLFEQRCGMCHSLQQAPGKMGPPLAGVVGRKAAS
FPGYTYSAALKGSGITWTADKLDAYSKAPTKVVPGTKMLLGAPNDAERAAVIAYLASVKK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaaggttcggcttaccctggcggcggtgttcgcagccctggcgtctggcgcggtc
gccgcgccgtctggacagcagctgttcgagcagcggtgcggcatgtgccattcgctgcag
caggctcccggcaagatggggccgcccttggcgggtgtggtcggtcgcaaggcggcgagc
tttccgggctacacctacagcgcggcgctgaagggctcgggaatcacctggaccgccgac
aagctcgacgcctattcgaaggccccgaccaaggtcgtgccgggcaccaagatgctgttg
ggagcgcccaacgacgccgagcgcgcggcggtgatcgcctatctggccagcgtcaagaaa
tag

DBGET integrated database retrieval system