KEGG   Caulobacter crescentus NA1000: CCNA_01764Help
Entry
CCNA_01764        CDS       T00841                                 

Definition
DNA polymerase III, chi subunit (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ccs  Caulobacter crescentus NA1000
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ccs00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ccs00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ccs03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ccs03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ccs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1893601..1894062
Genome map
AA seq 153 aa AA seqDB search
MTANPCEVWFYHLERSPLEAVLPELLEKTLGRGWKALVRGGDPRRIEALDQHLWTWREDS
FLPHGLASEPMAERQPVLLTAAEGNPNSGDALFLIDGAEPGDLSGVSRCILLFDGRDDQA
LAQARGRWSTFKKAGHPVSYWRQGAERGWEKQA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacggctaacccctgcgaggtctggttctatcacctcgagcgctcgccgctcgaggcg
gtgctgcccgagctcctggaaaagacgctggggcgcggctggaaggcgctggtgcgcggc
ggcgatccgcgccggatcgaggccctggatcagcatctctggacctggcgggaggacagc
ttcctgccgcatggcctggccagcgagccgatggccgagcgacagcccgtgctgctgacc
gccgcagagggaaaccccaacagcggcgatgcgctgtttctcatcgacggggccgaacct
ggagatctttcaggggtttcgcgctgcatcctcttgttcgacgggcgtgacgatcaggcc
ttggcgcaggcgcgcggacgttggtcgacgttcaagaaggccgggcatccggtgtcgtac
tggcgccagggcgccgagcggggttgggagaagcaggcatga

DBGET integrated database retrieval system